DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hcf and Klhdc9

DIOPT Version :9

Sequence 1:NP_524621.2 Gene:Hcf / 43788 FlyBaseID:FBgn0039904 Length:1500 Species:Drosophila melanogaster
Sequence 2:NP_001101820.1 Gene:Klhdc9 / 360878 RGDID:1561025 Length:350 Species:Rattus norvegicus


Alignment Length:238 Identity:60/238 - (25%)
Similarity:87/238 - (36%) Gaps:80/238 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QATKWEWRKMYPESPDSGLSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILD- 218
            :.:.|.||   |.:.|:.|:   |..||.|.:..:.:|.|||.    :....:|.  ||..|.| 
  Rat    11 RGSTWTWR---PVARDALLA---RAFHSCTELEGRFYLVGGLL----EGGARVPS--NDTVIFDP 63

  Fly   219 ---------TRG--VHSHN------GKWIVPKTYGDSPPPRESHTGISFATKSNGNLNLLIYGGM 266
                     .||  :.||:      |:|                              |.:.||.
  Rat    64 ARGQAVRLLARGGPLRSHHDAALVGGRW------------------------------LCVVGGW 98

  Fly   267 SGC-RLGDLWLLETDSMTW----SKPKTSGEAPLPRSLHSSTMIGNKMYVFGGWVPLVINDSKST 326
            .|. ||..:..|:|.|..|    :||.....|.|  |.|:.|.|.::.:...|      .:..:.
  Rat    99 DGSRRLSTVAALDTSSGVWEVWTAKPANCPPAGL--SSHTCTRISDREFRVSG------REGGTR 155

  Fly   327 TEREWKCTNTLAVLDLETMTWENVTLDTVEENVPRA-RAGHCA 368
            |:|.:....||. ||..|.|:     ...||....| |:||||
  Rat   156 TQRRYGSIYTLK-LDHSTRTY-----CYKEEGCHTASRSGHCA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HcfNP_524621.2 Kelch_1 73..110 CDD:279660
KELCH repeat 74..115 CDD:276965
KELCH repeat 123..175 CDD:276965 6/19 (32%)
Kelch_3 132..184 CDD:290151 9/28 (32%)
Kelch_5 175..221 CDD:290565 13/55 (24%)
KELCH repeat 178..239 CDD:276965 19/78 (24%)
Kelch_3 260..305 CDD:290151 17/49 (35%)
KELCH repeat 297..360 CDD:276965 15/62 (24%)
Kelch_3 306..371 CDD:290151 17/64 (27%)
FN3 <1307..1338 CDD:238020
FN3 1344..1448 CDD:238020
Klhdc9NP_001101820.1 KELCH repeat 28..76 CDD:276965 14/53 (26%)
KELCH repeat 79..119 CDD:276965 14/69 (20%)
Kelch 94..137 CDD:128874 15/44 (34%)
KELCH repeat 187..245 CDD:276965 5/6 (83%)
Kelch_5 256..295 CDD:404696
KELCH repeat 259..311 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.