DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hcf and KLHDC1

DIOPT Version :10

Sequence 1:NP_524621.2 Gene:Hcf / 43788 FlyBaseID:FBgn0039904 Length:1500 Species:Drosophila melanogaster
Sequence 2:NP_751943.1 Gene:KLHDC1 / 122773 HGNCID:19836 Length:406 Species:Homo sapiens


Alignment Length:343 Identity:93/343 - (27%)
Similarity:155/343 - (45%) Gaps:74/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RHGHRAINIKELMVVFGG-----GNEGIV--DELHVYNTVTNQWYVPVLKGDVPNGCA-AYGFVV 130
            |.||.|:.....:.|:||     .||..:  ||:..|:..:..|.:.:::|::|...: :.|..:
Human    13 RSGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYDIDSGLWRMHLMEGELPASMSGSCGACI 77

  Fly   131 EGTRMFVFGGMIEYGKYSNELYELQ-ATKWE---WRKMYPESPDSGLSPCPRLGHSFTMVGEKIF 191
            .| ::::|||..:.| |||.||.:. .|:.|   |.|:   :...|..|.||...|..:..:::.
Human    78 NG-KLYIFGGYDDKG-YSNRLYFVNLRTRDETYIWEKI---TDFEGQPPTPRDKLSCWVYKDRLI 137

  Fly   192 LFGGLA----NESDD---------PKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPP-PR 242
            .|||..    :|..|         .:.....:.||::|.||:     ...|..|:..|..|| ||
Human   138 YFGGYGCRRHSELQDCFDVHDASWEEQIFWGWHNDVHIFDTK-----TQTWFQPEIKGGVPPQPR 197

  Fly   243 ESHTGISFATKSNGNLNLLIYGG-MSGCRLGDLWLLETDSMTWSKPKT-SGEAPLPRSLHSSTMI 305
            .:||......|.      .|:|| :...|:.||..|..|:.|||...| :||:|..||.|:.|.|
Human   198 AAHTCAVLGNKG------YIFGGRVLQTRMNDLHYLNLDTWTWSGRITINGESPKHRSWHTLTPI 256

  Fly   306 G-NKMYVFGGW----VPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVP--RAR 363
            . :|:::.||.    :||  :|.       |       :.::.|..|:.:|      ::|  |.|
Human   257 ADDKLFLCGGLSADNIPL--SDG-------W-------IHNVTTNCWKQLT------HLPKTRPR 299

  Fly   364 AGHCA-VGIQSRLYVWSG 380
            ..|.| :|.::.:.|:.|
Human   300 LWHTACLGKENEIMVFGG 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HcfNP_524621.2 PLN02193 <59..363 CDD:177844 87/323 (27%)
KELCH repeat 74..115 CDD:276965 13/47 (28%)
KELCH repeat 123..175 CDD:276965 16/56 (29%)
KELCH repeat 178..239 CDD:276965 15/73 (21%)
KELCH repeat 297..360 CDD:276965 15/67 (22%)
FN3 <1307..>1381 CDD:442628
FN3 <1307..1338 CDD:238020
FN3 1344..1448 CDD:238020
KLHDC1NP_751943.1 NanM <10..93 CDD:442289 21/81 (26%)
KELCH repeat 13..65 CDD:276965 14/51 (27%)
Kelch 1 24..76 12/51 (24%)
NanM 63..327 CDD:442289 80/293 (27%)
KELCH repeat 69..194 CDD:276965 33/134 (25%)
Kelch 2 80..134 18/57 (32%)
Kelch 3 135..181 10/50 (20%)
KELCH repeat 197..235 CDD:276965 13/43 (30%)
Kelch 4 208..258 21/55 (38%)
KELCH repeat 248..294 CDD:276965 15/67 (22%)
Kelch 5 260..307 15/68 (22%)
Kelch 6 311..361 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.