DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hcf and RABEPK

DIOPT Version :9

Sequence 1:NP_524621.2 Gene:Hcf / 43788 FlyBaseID:FBgn0039904 Length:1500 Species:Drosophila melanogaster
Sequence 2:XP_005251697.1 Gene:RABEPK / 10244 HGNCID:16896 Length:380 Species:Homo sapiens


Alignment Length:415 Identity:108/415 - (26%)
Similarity:156/415 - (37%) Gaps:81/415 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WKRVLNPTGPQPRPRHGHRAI------NIKELMV-VFGGGNEG-IVDELHVYNTVTNQWYVPVLK 116
            |..:..| |..|..|.||...      |.|...| :.||.|.. ...::|..:...:||.:...|
Human    26 WYTLTVP-GDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCK 89

  Fly   117 GDVPNGCAAYGFVVEGT--RMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRL 179
            |.:|....| .|:...|  |::||||..:.|. .|.|..|......|......||    .|.||.
Human    90 GLLPRYEHA-SFIPSCTPDRIWVFGGANQSGN-RNCLQVLNPETRTWTTPEVTSP----PPSPRT 148

  Fly   180 GH-SFTMVGEKIFLFGG---LANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPP 240
            .| |...:|.::::|||   .|....|.|         |::.|...:     .|..|:|.|:.|.
Human   149 FHTSSAAIGNQLYVFGGGERGAQPVQDTK---------LHVFDANTL-----TWSQPETLGNPPS 199

  Fly   241 PRESHTGISFATKSNGNLNLLIYGGMSGCRL-GDLWLLETDSMTWSKPKTSGEAPLPRSLHSSTM 304
            ||..|..::..||      |.|:||::|.|. .||..::...|.|.|...:|.||...:.||:..
Human   200 PRHGHVMVAAGTK------LFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVA 258

  Fly   305 IGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVPRARAGH--C 367
            :|..:|:|||..|....|             |:.....|...|..:..||:   :|..|..|  |
Human   259 MGKHVYIFGGMTPAGALD-------------TMYQYHTEEQHWTLLKFDTL---LPPGRLDHSMC 307

  Fly   368 AVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTHALELSWTATTFAA 432
            .:       .|.......|..:|.:....    |..|...|.||......:|  |.|.|||....
Human   308 II-------PWPVTCASEKEDSNSLTLNH----EAEKEDSADKVMSHSGDSH--EESQTATLLCL 359

  Fly   433 AYVLQIQKIEQPLNTSSKLLSNNIV 457
            .:        ..:||..::..:.||
Human   360 VF--------GGMNTEGEIYDDCIV 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HcfNP_524621.2 Kelch_1 73..110 CDD:279660 10/44 (23%)
KELCH repeat 74..115 CDD:276965 12/48 (25%)
KELCH repeat 123..175 CDD:276965 15/53 (28%)
Kelch_3 132..184 CDD:290151 18/54 (33%)
Kelch_5 175..221 CDD:290565 14/49 (29%)
KELCH repeat 178..239 CDD:276965 16/64 (25%)
Kelch_3 260..305 CDD:290151 16/45 (36%)
KELCH repeat 297..360 CDD:276965 14/62 (23%)
Kelch_3 306..371 CDD:290151 16/66 (24%)
FN3 <1307..1338 CDD:238020
FN3 1344..1448 CDD:238020
RABEPKXP_005251697.1 KELCH repeat 39..85 CDD:276965 12/45 (27%)
Kelch_2 39..84 CDD:284956 11/44 (25%)
KELCH repeat 94..143 CDD:276965 15/54 (28%)
Kelch_3 107..155 CDD:290151 17/52 (33%)
KELCH repeat 147..197 CDD:276965 16/63 (25%)
Kelch_3 157..209 CDD:290151 17/65 (26%)
Kelch_1 200..243 CDD:279660 16/48 (33%)
KELCH repeat 201..248 CDD:276965 16/52 (31%)
Kelch_1 251..291 CDD:279660 12/52 (23%)
KELCH repeat 251..291 CDD:276965 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1494
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.