DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rad23 and OASL

DIOPT Version :9

Sequence 1:	NP_001259052.1	Gene:	Rad23 / 43785	FlyBaseID:	FBgn0026777	Length:	414	Species:	Drosophila melanogaster
Sequence 2:	NP_003724.1	Gene:	OASL / 8638	HGNCID:	8090	Length:	514	Species:	Homo sapiens

Alignment Length:	70	Identity:	16/70 - (22%)
Similarity:	38/70 - (54%)	Gaps:	4/70 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 ITIKNLQQQTFTIEFAPEKTVLELKKKIFEERG-PEYVAEKQKLIYAGVILTDDRTVGSYNVDEK 66
            :.:||....::.....|...:|.||::|.:::| |:   ::|:|.:.|.:|.|...:|.|.:.:.
Human   436 VFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPK---KQQQLEFQGQVLQDWLGLGIYGIQDS 497

  Fly    67 KFIVV 71
            ..:::
Human   498 DTLIL 502

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rad23	NP_001259052.1	rad23	1..413	CDD:273167	16/70 (23%)
		RAD23_N	1..76	CDD:176400	16/70 (23%)
		UBA1_Rhp23p_like	153..199	CDD:270561
		XPC-binding	242..296	CDD:286376
		UBA2_HR23A	371..411	CDD:270610
OASL	NP_003724.1	NT_2-5OAS_ClassI-CCAase	29..212	CDD:143390
		OAS1_C	168..351	CDD:313619
		OASL_repeat1	354..433	CDD:176406
		ubiquitin	436..506	CDD:306702	16/70 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900