powered by:
Protein Alignment Rad23 and OASL
DIOPT Version :9
Sequence 1: | NP_001259052.1 |
Gene: | Rad23 / 43785 |
FlyBaseID: | FBgn0026777 |
Length: | 414 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003724.1 |
Gene: | OASL / 8638 |
HGNCID: | 8090 |
Length: | 514 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
Similarity: | 38/70 - (54%) |
Gaps: | 4/70 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 ITIKNLQQQTFTIEFAPEKTVLELKKKIFEERG-PEYVAEKQKLIYAGVILTDDRTVGSYNVDEK 66
:.:||....::.....|...:|.||::|.:::| |: ::|:|.:.|.:|.|...:|.|.:.:.
Human 436 VFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPK---KQQQLEFQGQVLQDWLGLGIYGIQDS 497
Fly 67 KFIVV 71
..:::
Human 498 DTLIL 502
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.