DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and DSK2

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_014003.1 Gene:DSK2 / 855319 SGDID:S000004889 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:344 Identity:77/344 - (22%)
Similarity:126/344 - (36%) Gaps:85/344 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKKFIVVMLT 74
            |..:.:..|||.|||:.|:.|.:..|  .....|:|||:|.||.||:||.||::.:...:.::  
Yeast    11 QDKWEVNVAPESTVLQFKEAINKANG--IPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV-- 71

  Fly    75 RDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRPLSSDELIGE 139
              .|.......|...:|..|:|.         .|..|.:..:.::..|........|:|....|.
Yeast    72 --KSQPKPQTASAAGANNATATG---------AAAGTGATPNMSSGQSAGFNPLADLTSARYAGY 125

  Fly   140 LAQASLQS-RAESNLLMGDEYNQ-TVLSMVEMGYPREQVERAMAASYNNPERAVEYLINGIPAEE 202
            |...|... ..:...|..|..|| .:|.|:|....:.|:...:    :||: .::::|       
Yeast   126 LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEML----SNPQ-MLDFMI------- 178

  Fly   203 GTFYNRLNESTNPSLIPSGPQPASATSAERSTESNSDPFEFLRSQPQFLQMRSLIYQNPHLLHAV 267
                     .:||.|...|||..                :.|:| |.|.||.:    ||.::...
Yeast   179 ---------QSNPQLQAMGPQAR----------------QMLQS-PMFRQMLT----NPDMIRQS 213

  Fly   268 LQQIGQTNPALLQLISENQDAFLNMLNQPIDRESESG-ATVPPVSNARIPSTLDNVDLFSPDLEV 331
            :|                   |..|::......|..| |:..|......|....|.:..|     
Yeast   214 MQ-------------------FARMMDPNAGMGSAGGAASAFPAPGGDAPEEGSNTNTTS----- 254

  Fly   332 ATSAQRSAAGTSAAHQSGS 350
             :|...:.|||:|...:|:
Yeast   255 -SSNTGNNAGTNAGTNAGA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 77/344 (22%)
RAD23_N 1..76 CDD:176400 23/65 (35%)
UBA1_Rhp23p_like 153..199 CDD:270561 11/46 (24%)
XPC-binding 242..296 CDD:286376 11/53 (21%)
UBA2_HR23A 371..411 CDD:270610
DSK2NP_014003.1 Ubl_Dsk2p_like 3..74 CDD:340523 23/68 (34%)
STI1 149..185 CDD:128966 9/56 (16%)
UBA_Dsk2p_like 328..369 CDD:270509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.