DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and LDH1

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_009763.2 Gene:LDH1 / 852503 SGDID:S000000408 Length:375 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:28/131 - (21%)
Similarity:48/131 - (36%) Gaps:46/131 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 QPASATSAE---RSTESNSDPFEFLRSQPQFLQMRSLIYQNPHLLHAVLQQIGQTNPALLQLISE 284
            :|.|..:.|   ::.|:.:|...::|.....|..|                        |:.|:|
Yeast    16 EPLSGKTLEEIVQNAENAADLVAYIRKPEVDLDFR------------------------LKFIAE 56

  Fly   285 NQDAFLNMLNQPIDRESE------------SGATVPPVSNARIPSTLDNVDLFSPDLEVATSAQR 337
            ::: |.|:  |..||.|.            .|.||    ...:|....|::.|.|.||:..|.|:
Yeast    57 HEE-FFNV--QLSDRNSRIRTCHNLSDKGIRGDTV----FVFVPGLAGNLEQFEPLLELVDSDQK 114

  Fly   338 S 338
            :
Yeast   115 A 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 28/131 (21%)
RAD23_N 1..76 CDD:176400
UBA1_Rhp23p_like 153..199 CDD:270561
XPC-binding 242..296 CDD:286376 8/53 (15%)
UBA2_HR23A 371..411 CDD:270610
LDH1NP_009763.2 EstA 4..375 CDD:224001 28/131 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.815465 Normalized mean entropy S1702
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.