DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and UBI4

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_013061.1 Gene:UBI4 / 850620 SGDID:S000003962 Length:381 Species:Saccharomyces cerevisiae


Alignment Length:368 Identity:79/368 - (21%)
Similarity:143/368 - (38%) Gaps:85/368 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDE 65
            |.|.:|.|..:|.|:|.....|:..:|.||.::.|  ...::|:||:||..|.|.||:..||:.:
Yeast     1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEG--IPPDQQRLIFAGKQLEDGRTLSDYNIQK 63

  Fly    66 KKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRP 130
            :..:.::|......    |:.||.....|.|.:.:           :|.:..|.:..:..:|..|
Yeast    64 ESTLHLVLRLRGGM----QIFVKTLTGKTITLEVE-----------SSDTIDNVKSKIQDKEGIP 113

  Fly   131 LSSDELI--GE-------LAQASLQSRAESNLLM----GDEY------NQTVLSMVEMGYPREQV 176
            .....||  |:       |:..::|..:..:|::    |.:.      .:|:...||.....:.|
Yeast   114 PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV 178

  Fly   177 ERAMAASYNNPERAVEYLINGIPAEEG---TFYNRLNESTNPSL--IPSGPQPASATSAERSTE- 235
            :..:......|......:..|...|:|   :.||...|||...:  :..|.|....|...::.. 
Yeast   179 KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL 243

  Fly   236 --SNSDPFEFLRSQPQFLQ-----MRSLIY----------------QNPHLLHAVLQ-----QI- 271
              .:||..:.::|:.|..:     .:.||:                |....||.||:     || 
Yeast   244 EVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF 308

  Fly   272 -----GQTNPALLQLISENQDAFLNMLNQPIDRESESGATVPP 309
                 |:|    :.|..|:.|...|:.::..|:|.     :||
Yeast   309 VKTLTGKT----ITLEVESSDTIDNVKSKIQDKEG-----IPP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 79/368 (21%)
RAD23_N 1..76 CDD:176400 24/74 (32%)
UBA1_Rhp23p_like 153..199 CDD:270561 8/55 (15%)
XPC-binding 242..296 CDD:286376 17/85 (20%)
UBA2_HR23A 371..411 CDD:270610
UBI4NP_013061.1 Ubl_ubiquitin 1..76 CDD:340501 24/76 (32%)
Ubl_ubiquitin 77..152 CDD:340501 15/89 (17%)
Ubl_ubiquitin 153..228 CDD:340501 13/74 (18%)
Ubl_ubiquitin 229..304 CDD:340501 13/74 (18%)
Ubl_ubiquitin 305..380 CDD:340501 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.