DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT1G11970

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_172661.1 Gene:AT1G11970 / 837749 AraportID:AT1G11970 Length:99 Species:Arabidopsis thaliana


Alignment Length:55 Identity:15/55 - (27%)
Similarity:22/55 - (40%) Gaps:15/55 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYN 62
            |.::...||..|...:.::|:.|.||.|               |.:||.|...||
plant    50 LSEKKIDIEIDPMDKIEQIKEGIEEEIG---------------IPSDDLTAEHYN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 15/55 (27%)
AT1G11970NP_172661.1 Ubl1_cv_Nsp3_N-like 44..97 CDD:475130 15/55 (27%)

Return to query results.
Submit another query.