DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT5G16090

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_197113.4 Gene:AT5G16090 / 831466 AraportID:AT5G16090 Length:171 Species:Arabidopsis thaliana


Alignment Length:141 Identity:41/141 - (29%)
Similarity:60/141 - (42%) Gaps:52/141 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 LQQIGQTNPALLQLISENQDAFLNMLNQPIDRESESGATVPPVSNARIPSTLDNVDLFSPDLEVA 332
            |:::.:.||.|.|:|..|...|:.:||    :||                       |..|.|: 
plant    79 LEEMEKQNPPLFQMIRHNSAGFVPVLN----KES-----------------------FERDNEL- 115

  Fly   333 TSAQRSAAGTSAAHQSGSAADNEDLEQPLGVSTIRLNRQDKDAIERLKALGFPEALVLQAYFACE 397
                              |...|||.|      :::...|.:||.||:|:||...:||:.:.||.
plant   116 ------------------AQPEEDLLQ------LQVTAVDDEAINRLEAMGFERRVVLEVFLACN 156

  Fly   398 KNEEQAANFLL 408
            |||:.||||||
plant   157 KNEQLAANFLL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 41/141 (29%)
AT5G16090NP_197113.4 Ubl_Rad23 1..74 CDD:340503
rad23 <79..171 CDD:273167 41/141 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.