DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rad23 and AT5G16090

DIOPT Version :9

Sequence 1:	NP_001259052.1	Gene:	Rad23 / 43785	FlyBaseID:	FBgn0026777	Length:	414	Species:	Drosophila melanogaster
Sequence 2:	NP_197113.4	Gene:	AT5G16090 / 831466	AraportID:	AT5G16090	Length:	171	Species:	Arabidopsis thaliana

Alignment Length:	141	Identity:	41/141 - (29%)
Similarity:	60/141 - (42%)	Gaps:	52/141 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   268 LQQIGQTNPALLQLISENQDAFLNMLNQPIDRESESGATVPPVSNARIPSTLDNVDLFSPDLEVA 332
            |:::.:.||.|.|:|..|...|:.:||    :||                       |..|.|:
plant    79 LEEMEKQNPPLFQMIRHNSAGFVPVLN----KES-----------------------FERDNEL- 115

  Fly   333 TSAQRSAAGTSAAHQSGSAADNEDLEQPLGVSTIRLNRQDKDAIERLKALGFPEALVLQAYFACE 397
                              |...|||.|      :::...|.:||.||:|:||...:||:.:.||.
plant   116 ------------------AQPEEDLLQ------LQVTAVDDEAINRLEAMGFERRVVLEVFLACN 156

  Fly   398 KNEEQAANFLL 408
            |||:.||||||
plant   157 KNEQLAANFLL 167

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rad23	NP_001259052.1	rad23	1..413	CDD:273167	41/141 (29%)
		RAD23_N	1..76	CDD:176400
		UBA1_Rhp23p_like	153..199	CDD:270561
		XPC-binding	242..296	CDD:286376	10/27 (37%)
		UBA2_HR23A	371..411	CDD:270610	21/38 (55%)
AT5G16090	NP_197113.4	UBQ	1..76	CDD:294102
		UBQ	1..70	CDD:214563
		UBA_like_SF	127..169	CDD:304366	21/41 (51%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	55	1.000	Domainoid score	I4098
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1260050at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.820