DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT4G02950

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_192204.1 Gene:AT4G02950 / 828123 AraportID:AT4G02950 Length:318 Species:Arabidopsis thaliana


Alignment Length:220 Identity:55/220 - (25%)
Similarity:86/220 - (39%) Gaps:60/220 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKK 67
            :.|:|....:|||:.:...|||.:|:||...:|..  ..||.||:...:|.|...:....:....
plant    38 VIIENQSGSSFTIDVSFWDTVLMIKRKIEMTQGTP--VSKQILIFKRKVLQDHLNMFGCQIRHNS 100

  Fly    68 FIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEE-ANHTNSPSSTNTEDSVLSRE---- 127
            .|::.::.|   .|..|..|.::|:..||    .|.|..| .|:.:||.|  .:.|.|:.|    
plant   101 RILLSISPD---DNPTQNQVPQTNQSPST----PSNPIHEFVNNQDSPLS--PQSSALTMEKFSK 156

  Fly   128 --------------------TRP-LSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGY 171
                                :|| .|.|||        |..|..|.:.:|...|           
plant   157 NQQDRPPLMRVVAKRIDNGSSRPSYSLDEL--------LAPRDSSTVAVGSIRN----------- 202

  Fly   172 PREQVERAMAASYNNPERAVEYLIN 196
             |:|..:...:|   |..:||.:||
plant   203 -RDQEVKNRESS---PSDSVEEVIN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 55/220 (25%)
RAD23_N 1..76 CDD:176400 19/72 (26%)
UBA1_Rhp23p_like 153..199 CDD:270561 10/44 (23%)
XPC-binding 242..296 CDD:286376
UBA2_HR23A 371..411 CDD:270610
AT4G02950NP_192204.1 UBQ 36..104 CDD:214563 19/67 (28%)
ubiquitin 42..109 CDD:278661 18/68 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.