DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT7SL-1

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_192206.1 Gene:AT7SL-1 / 828121 AraportID:AT4G02970 Length:270 Species:Arabidopsis thaliana


Alignment Length:266 Identity:67/266 - (25%)
Similarity:103/266 - (38%) Gaps:57/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKKFIVVMLTRD 76
            :.||:|.  :||||:|:||.:.:|  ....||.|...|..|.||.....|.:   .|...:|.|.
plant    14 SITIDFG--ETVLEIKEKIEKSQG--IPVSKQILYLDGKALEDDLHKIDYMI---LFESRLLLRI 71

  Fly    77 SSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRPL-------SSD 134
            |..::.|| |.:::.:....||.||.. |...:.:.|...|.    |::|....:       |.|
plant    72 SPDADPNQ-SNEQTEQSKQIDDKKQEF-CGIQDSSESKKITR----VMARRVHNIYSSLPAYSLD 130

  Fly   135 ELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQVERAMAAS--YNNPERAVEYLING 197
            ||:|        .:..:.:.:|...||.|       .|.||...:..|.  ..:.:..||..|  
plant   131 ELLG--------PKYSATVAVGGRTNQVV-------QPTEQASTSGTAKEVLRDSDSPVEKKI-- 178

  Fly   198 IPAEEGTFYNRLNESTNPSLIPSGPQPASATSAERSTESNSDP-FEFLRSQPQFLQMR---SLIY 258
                          .|||.......:|....:.....|.|:|. .|.||.:...:|.|   :|.:
plant   179 --------------KTNPMKFTVHVKPYQEDTRMIHVEVNADDNVEELRKELVKMQERGELNLPH 229

  Fly   259 QNPHLL 264
            :..|||
plant   230 EAFHLL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 67/266 (25%)
RAD23_N 1..76 CDD:176400 21/63 (33%)
UBA1_Rhp23p_like 153..199 CDD:270561 11/47 (23%)
XPC-binding 242..296 CDD:286376 9/26 (35%)
UBA2_HR23A 371..411 CDD:270610
AT7SL-1NP_192206.1 UBQ 1..69 CDD:214563 20/61 (33%)
ubiquitin 7..74 CDD:278661 23/66 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.