DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and EVE1

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_192244.1 Gene:EVE1 / 827964 AraportID:AT4G03350 Length:263 Species:Arabidopsis thaliana


Alignment Length:280 Identity:65/280 - (23%)
Similarity:106/280 - (37%) Gaps:72/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKKFIVVMLTRD 76
            :.||:|.  :|||::|:||.:.:|  ....||.|...|..|.||    .:.:|.......:|.|.
plant    14 SITIDFG--ETVLQIKEKIEKSQG--IPVSKQILYLDGKALEDD----LHKIDYMILFESLLLRI 70

  Fly    77 SSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRPL-------SSD 134
            |..::.|| |.:::.:....||.||.. |...:.:.|...|.    |::|....:       |.|
plant    71 SPDADPNQ-SNEQTEQSKQIDDKKQEF-CGIQDSSESKKLTR----VMARRVHNVYSSLPAYSLD 129

  Fly   135 ELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEYLINGIP 199
            ||:|        .:..:.:.:|...||.|          :..|:|                    
plant   130 ELLG--------PKYSATVTVGGRTNQVV----------QTTEQA-------------------- 156

  Fly   200 AEEGTFYNRLNES---------TNPSLIPSGPQPASATSAERSTESNSDP-FEFLRSQPQFLQMR 254
            :..||....|.:|         |||.......:|....:.....|.|:|. .|.||.:...:|.|
plant   157 STSGTAKEVLRDSDSPVEKKIKTNPMKFTVHVKPYQEDTKMIQVEVNADDNVEELRKELVKMQER 221

  Fly   255 ---SLIYQNPHLLHAVLQQI 271
               :|.::..||:.:.|..|
plant   222 GELNLPHEAFHLVSSELPLI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 65/280 (23%)
RAD23_N 1..76 CDD:176400 19/63 (30%)
UBA1_Rhp23p_like 153..199 CDD:270561 6/45 (13%)
XPC-binding 242..296 CDD:286376 10/33 (30%)
UBA2_HR23A 371..411 CDD:270610
EVE1NP_192244.1 ubiquitin 5..73 CDD:306702 21/66 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.