DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT4G03360

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_192245.2 Gene:AT4G03360 / 827958 AraportID:AT4G03360 Length:322 Species:Arabidopsis thaliana


Alignment Length:301 Identity:72/301 - (23%)
Similarity:114/301 - (37%) Gaps:80/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKK 67
            :.|:|....:|||:.:...|||.:|:||...:|..  ..||.||:...:|.|...:....:....
plant    42 VIIENQSGSSFTIDVSFWDTVLMIKRKIEMTQGTP--VSKQILIFKRKVLQDHLNMFGCQIRHNS 104

  Fly    68 FIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEE-ANHTNSPSSTNTEDSVLSRE---- 127
            .|::.::.|   .|..|..|.::|:..||    .|.|..| .|:.:||.|  .:.|.|:.|    
plant   105 RILLSISPD---DNPTQNQVPQTNQSPST----PSNPIHEFVNNQDSPLS--PKSSALTMEKFSK 160

  Fly   128 --------------------TRP-LSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGY 171
                                :|| .|.|||        |..|..|.:.:|...|           
plant   161 NQQDRPPLMRVVAKRIDNGSSRPSYSLDEL--------LAPRDSSTVAVGSIRN----------- 206

  Fly   172 PREQVERAMAASYNNPERAVEYLINGIPAEEGTFYNRLNESTNPSLIPSGPQPASATSAERSTES 236
             |:|..:...:|   |..:||.:||            :.:|....:|.. .||...|...:...:
plant   207 -RDQEVKNRVSS---PSDSVEEVIN------------ITDSLAMKMIVM-VQPYGYTRMIQVEVT 254

  Fly   237 NSDPFEFLRSQPQFLQMR---SLIYQNPHLLH----AVLQQ 270
            ..|..|.||.:...:|.|   :|.....:|:|    |||.:
plant   255 ADDNVEELRKELVKMQERGELNLPQGMYYLIHKHKQAVLHE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 72/301 (24%)
RAD23_N 1..76 CDD:176400 19/72 (26%)
UBA1_Rhp23p_like 153..199 CDD:270561 10/45 (22%)
XPC-binding 242..296 CDD:286376 11/36 (31%)
UBA2_HR23A 371..411 CDD:270610
AT4G03360NP_192245.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.