DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT4G03370

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_192246.1 Gene:AT4G03370 / 827951 AraportID:AT4G03370 Length:295 Species:Arabidopsis thaliana


Alignment Length:367 Identity:72/367 - (19%)
Similarity:145/367 - (39%) Gaps:94/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKI-FEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVD 64
            |.:|::|....||:|:...:.|||..|:|| ..:|.|   ..:|.:.:.|.:|.|...:..:::.
plant     1 MKMTVENESGSTFSIDIGLQDTVLTFKRKIEMTQRIP---VSRQTIFFQGKLLEDHLDIFEWDIL 62

  Fly    65 EKKFIVVMLTRDSSSSNRNQLSVKESNKL-------TSTDDSKQSMPCEEANHTNSP---SSTNT 119
            :...:.:.::.|.:.: :||:....||.:       .|.:|.|..:...:......|   |...|
plant    63 QNPLLHLSISPDDNPT-QNQVPQSPSNPIHEFVKNQDSAEDKKNPVLLHQTGKPPLPPKSSPLTT 126

  Fly   120 EDSVLSRETRPLSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASY 184
            |:...::..||:.: :::.||    |..:..|.:.:|...|:.           ::|:..:::|.
plant   127 ENFSKNQHDRPVIT-KMVPEL----LGPQGTSPVTVGRRRNRD-----------QEVQNRVSSSS 175

  Fly   185 NNPERAVEYLINGIPAEEGTFYNRLNESTNPSLIPSGPQPASATSAERSTESNS-------DPFE 242
            :    :|:.:||                     ||..|       |.:.|::..       .|||
plant   176 D----SVKEVIN---------------------IPDTP-------ARKKTKNYPLKITVMVQPFE 208

  Fly   243 FLRSQPQFLQMRSLIYQNPHLLHAVL---QQIGQTN-PALLQLISENQDAFLNMLNQPIDRESES 303
            ..|.    :|:...:..|..:|...|   |:.|:.| |         .:.|..:..|.:.||.:|
plant   209 ETRR----IQVEVNVLSNVEVLRKELVKMQERGELNLP---------HEGFFFIHKQDVLREDQS 260

  Fly   304 GATVPPVSNARIPSTLDNVDLFSPDLEVATSAQRSAAGTSAA 345
            .     ::|...|.  |.:::|...:....|..|:....|::
plant   261 F-----MANRVAPG--DTIEIFQGYVTYTGSLPRTVRKLSSS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 72/367 (20%)
RAD23_N 1..76 CDD:176400 18/75 (24%)
UBA1_Rhp23p_like 153..199 CDD:270561 7/45 (16%)
XPC-binding 242..296 CDD:286376 11/57 (19%)
UBA2_HR23A 371..411 CDD:270610
AT4G03370NP_192246.1 ubiquitin 4..74 CDD:365970 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.