DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and UBL4A

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_055050.1 Gene:UBL4A / 8266 HGNCID:12505 Length:157 Species:Homo sapiens


Alignment Length:188 Identity:34/188 - (18%)
Similarity:73/188 - (38%) Gaps:42/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDE 65
            |.:|:|.||.:..:::...::.|..||:.:.|:.  .....:|:|::.|..|.|.:.:..|::  
Human     1 MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKL--NVPVRQQRLLFKGKALADGKRLSDYSI-- 61

  Fly    66 KKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRP 130
                        ..:::..|.||...|:...:...|.:.     .:..|........||:|....
Human    62 ------------GPNSKLNLVVKPLEKVLLEEGEAQRLA-----DSPPPQVWQLISKVLARHFSA 109

  Fly   131 LSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPE 188
            ..:..::.:|.:.  ..|:.|.|.:.|                  :|| :|:.:.:||
Human   110 ADASRVLEQLQRD--YERSLSRLTLDD------------------IER-LASRFLHPE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 34/188 (18%)
UBL4ANP_055050.1 Ubl_UBL4A_like 1..72 CDD:340505 16/86 (19%)
Tugs 96..142 CDD:465528 11/66 (17%)
Required and sufficient for interaction with BAG6. /evidence=ECO:0000269|PubMed:25535373, ECO:0000269|PubMed:25713138 96..138 10/62 (16%)

Return to query results.
Submit another query.