DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT4G05310

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_192440.1 Gene:AT4G05310 / 825879 AraportID:AT4G05310 Length:415 Species:Arabidopsis thaliana


Alignment Length:331 Identity:67/331 - (20%)
Similarity:118/331 - (35%) Gaps:119/331 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGV-ILTDDRTVGSYNVD 64
            |...::.|...:|.||.....|:|.:|:||  |:.......||.||..|: ||.:|     .|:|
plant     1 MKFVVEILGGSSFEIEVERTDTLLVVKQKI--EKSQRVPVSKQTLIVDGIFILRED-----LNLD 58

  Fly    65 EKKFIVVMLTRDSSSSNRNQLSVK-ESNKLTSTDD----SKQSMPC------------------E 106
            :     ..:..||    :.||.|. :.|.:.:.||    ::||.|.                  |
plant    59 Q-----CQIFHDS----QIQLEVSPDVNPIHNNDDQIPQTEQSPPAPWISVEEYFAEQDWPLTEE 114

  Fly   107 EAN--HTNSPSST----NTEDSVLSRETRPLSSDELIGELAQASLQSRAESNLLMGDEYNQTVLS 165
            |..  ::..|.:|    ..:|:..:.|:.|.:|.:....:..:|::..:::|   .|:...|   
plant   115 EIRKIYSYRPETTQDISKIQDAHQTEESPPSNSVKETVNIQDSSVKFASKNN---NDQVPPT--- 173

  Fly   166 MVEMGYPREQVERAMAASYNNPERAVEYLI--------NGIP----------------------A 200
               ..:|:..:.:.:.   |..:|..:.|:        |.:|                      |
plant   174 ---KQFPQSNLVKKIT---NGKKRVRQMLVYVSPYPGMNEVPTNILVQVKVTDEVKTLRGLMKLA 232

  Fly   201 EEGTFYNRLNESTNPS---------------LIP-------SGPQPASAT----SAERSTESNS- 238
            :||..:...|:..|..               ::|       |..|.:|.|    ..|:|..||| 
plant   233 QEGYIFTHNNQVLNEDQSYECNSVKPLDTIVIVPRRVIQETSKIQDSSVTVQVPQMEQSPASNSV 297

  Fly   239 ----DP 240
                ||
plant   298 KEITDP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 67/331 (20%)
RAD23_N 1..76 CDD:176400 21/75 (28%)
UBA1_Rhp23p_like 153..199 CDD:270561 7/53 (13%)
XPC-binding 242..296 CDD:286376
UBA2_HR23A 371..411 CDD:270610
AT4G05310NP_192440.1 UBQ 1..73 CDD:214563 25/87 (29%)
ubiquitin 8..75 CDD:278661 25/82 (30%)
DUF5031 73..>174 CDD:293043 18/109 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.