DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT4G05240

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_192433.1 Gene:AT4G05240 / 825872 AraportID:AT4G05240 Length:197 Species:Arabidopsis thaliana


Alignment Length:116 Identity:30/116 - (25%)
Similarity:49/116 - (42%) Gaps:19/116 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKKFIVVM 72
            |....|.||.....||||:|:||  |:....:..:|.|.:.|.:|.|       ::|.::.::: 
plant    65 LPNYKFEIELGYWDTVLEIKQKI--EKYQRILVYRQTLFFQGNVLQD-------HLDIEQCVIL- 119

  Fly    73 LTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSS-TNTEDS 122
                    |.:.|.|..........|:.|.:..||:...||... .|.:||
plant   120 --------NHSLLKVFVDPYRNPNHDNDQMLQTEESPPLNSAKEIVNVQDS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 30/116 (26%)
RAD23_N 1..76 CDD:176400 18/67 (27%)
UBA1_Rhp23p_like 153..199 CDD:270561
XPC-binding 242..296 CDD:286376
UBA2_HR23A 371..411 CDD:270610
AT4G05240NP_192433.1 Ubiquitin_like_fold 65..130 CDD:391949 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.