DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT4G05230

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_192432.1 Gene:AT4G05230 / 825871 AraportID:AT4G05230 Length:206 Species:Arabidopsis thaliana


Alignment Length:182 Identity:44/182 - (24%)
Similarity:80/182 - (43%) Gaps:46/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKKFIV-----V 71
            ||.||.....||||:|:||  |:.......||.|::.|.:|.|       ::|.::.::     :
plant    12 TFEIELGYWDTVLEIKQKI--EKYQRIPVSKQTLLFQGNVLQD-------HLDIEQCVILNHSRI 67

  Fly    72 MLTRDSSSSNRNQLSVKESNKLTSTDDSKQS----------MPCEEANHTNSPSSTNTEDSVLSR 126
            .|:..|...:||.:.|.::.:...::.::|:          :|....|:.|:|.....  .||.:
plant    68 QLSISSPDQSRNNIQVFKTEQFPQSNSTEQTSNGHHESTVMIPMSNNNNNNNPKKLRV--MVLPK 130

  Fly   127 E-TRPLSSD----ELIGELAQ--ASLQSRAESNLLMGDEYNQTVLSMVEMGY 171
            . ||.:..|    :.:|||.:  |.:|.|.:             ||:.:.||
plant   131 SGTRKIPVDVNAGDNVGELRKELAKIQQRFQ-------------LSLPQEGY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 44/182 (24%)
RAD23_N 1..76 CDD:176400 20/68 (29%)
UBA1_Rhp23p_like 153..199 CDD:270561 4/19 (21%)
XPC-binding 242..296 CDD:286376
UBA2_HR23A 371..411 CDD:270610
AT4G05230NP_192432.1 UBQ 1..69 CDD:214563 19/65 (29%)
ubiquitin 7..72 CDD:278661 20/68 (29%)
UBQ 130..198 CDD:176352 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.