DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and UBQ6

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_566095.1 Gene:UBQ6 / 819323 AraportID:AT2G47110 Length:157 Species:Arabidopsis thaliana


Alignment Length:93 Identity:26/93 - (27%)
Similarity:49/93 - (52%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDE 65
            |.|.:|.|..:|.|:|.....|:..:|.||.::.|  ...::|:||:||..|.|.||:..||:.:
plant     1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG--IPPDQQRLIFAGKQLEDGRTLADYNIQK 63

  Fly    66 KKFIVVMLTRDSSSSNRNQLSVKESNKL 93
            :..:.::|.....:..|.:.:..:..|:
plant    64 ESTLHLVLRLRGGAKKRKKKTYTKPKKI 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 26/93 (28%)
UBQ6NP_566095.1 Ubl_ubiquitin 1..76 CDD:340501 24/76 (32%)
Ribosomal_S27 103..147 CDD:460261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.