DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT2G32350

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_180794.2 Gene:AT2G32350 / 817796 AraportID:AT2G32350 Length:242 Species:Arabidopsis thaliana


Alignment Length:82 Identity:30/82 - (36%)
Similarity:42/82 - (51%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ITIKNLQQQTFTIEFAPEKTVLELKKKI-FEERGPEYVAEKQKLIYAGVILTDD-RTVGSYNVDE 65
            :|:|...:| ||:|....:||..||.|| ..|..|   .::.:|.|:|:.|.|| |.:..|.:.|
plant    77 VTVKFPSKQ-FTVEVDRTETVSSLKDKIHIVENTP---IKRMQLYYSGIELADDYRNLNEYGITE 137

  Fly    66 KKFIVVMLTRDSSSSNR 82
            ...|||.|    .|.||
plant   138 FSEIVVFL----KSINR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 30/82 (37%)
RAD23_N 1..76 CDD:176400 27/74 (36%)
UBA1_Rhp23p_like 153..199 CDD:270561
XPC-binding 242..296 CDD:286376
UBA2_HR23A 371..411 CDD:270610
AT2G32350NP_180794.2 Ubiquitin_like_fold 1..47 CDD:421700
ubiquitin 77..146 CDD:395184 27/76 (36%)
Ubiquitin_like_fold 169..232 CDD:421700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.