DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rad23 and RPS27A

DIOPT Version :9

Sequence 1:	NP_001259052.1	Gene:	Rad23 / 43785	FlyBaseID:	FBgn0026777	Length:	414	Species:	Drosophila melanogaster
Sequence 2:	NP_001129064.1	Gene:	RPS27A / 6233	HGNCID:	10417	Length:	156	Species:	Homo sapiens

Alignment Length:	135	Identity:	37/135 - (27%)
Similarity:	62/135 - (45%)	Gaps:	10/135 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDE 65
            |.|.:|.|..:|.|:|..|..|:..:|.||.::.|  ...::|:||:||..|.|.||:..||:.:
Human     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPDQQRLIFAGKQLEDGRTLSDYNIQK 63

  Fly    66 KKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRP 130
            :..:.::|        |.:...|:..|.:.|...|.....::............|:..:||..|.
Human    64 ESTLHLVL--------RLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE 120

  Fly   131 LSSDE 135
            ..|||
Human   121 CPSDE 125

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rad23	NP_001259052.1	rad23	1..413	CDD:273167	37/135 (27%)
		RAD23_N	1..76	CDD:176400	25/74 (34%)
		UBA1_Rhp23p_like	153..199	CDD:270561
		XPC-binding	242..296	CDD:286376
		UBA2_HR23A	371..411	CDD:270610
RPS27A	NP_001129064.1	Ubl_ubiquitin	1..76	CDD:340501	26/84 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	76..95		4/18 (22%)
		Ribosomal_S27	103..147	CDD:396259	7/23 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900