DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and RAD23A

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_024307399.1 Gene:RAD23A / 5886 HGNCID:9812 Length:382 Species:Homo sapiens


Alignment Length:312 Identity:97/312 - (31%)
Similarity:135/312 - (43%) Gaps:69/312 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPE-YVAEKQKLIYAGVILTDDRTVGSYNVDEK 66
            ||:|.||||||.|...|::||..||:||..|:|.: :....|||||||.||:||..:..|.:|||
Human     5 ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEK 69

  Fly    67 KFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRPL 131
            .|:|||:|:..:...   .|.......|:..:|..|.|....:..:.|.....||...|.|:.|.
Human    70 NFVVVMVTKTKAGQG---TSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPT 131

  Fly   132 SSDELI-GELAQASLQSRAE---SNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVE 192
            :|.|.: |.:..:....|.|   |.|:.|.||...:..::.|||.||:|..|:.||||||.||||
Human   132 TSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVE 196

  Fly   193 YLINGIPAEEGTFYNRLNES--------------------------------------------- 212
            ||:.|||......:..:.||                                             
Human   197 YLLTGIPGSPEPEHGSVQESQVSEQPATEAGGCAHAASALQVPDSHYTPPRSAPRSPAWCLTAPL 261

  Fly   213 -----TNPSLIPSGPQP----ASATSAERSTESN-------SDPFEFLRSQP 248
                 ..|..:|:||.|    |:..|||....:.       .:|..|..:||
Human   262 PTTSRREPPGVPAGPAPVPEHAAGDSAEPCAAARPAPAAGPGEPSAFTANQP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 97/312 (31%)
RAD23_N 1..76 CDD:176400 39/73 (53%)
UBA1_Rhp23p_like 153..199 CDD:270561 24/45 (53%)
XPC-binding 242..296 CDD:286376 3/7 (43%)
UBA2_HR23A 371..411 CDD:270610
RAD23AXP_024307399.1 UBQ 3..>228 CDD:333228 84/225 (37%)
DNA_pol3_gamma3 <81..378 CDD:331207 58/236 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159580
Domainoid 1 1.000 77 1.000 Domainoid score I8888
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 258 1.000 Inparanoid score I3144
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53856
OrthoDB 1 1.010 - - D1260050at2759
OrthoFinder 1 1.000 - - FOG0001474
OrthoInspector 1 1.000 - - otm42130
orthoMCL 1 0.900 - - OOG6_101279
Panther 1 1.100 - - LDO PTHR10621
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1097
SonicParanoid 1 1.000 - - X1039
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.