DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and CG10694

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster


Alignment Length:426 Identity:113/426 - (26%)
Similarity:179/426 - (42%) Gaps:150/426 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERG--PEYV--AEKQKLIYAGVILTDDRTVGSY 61
            |.::|:.|.|:|.|:|....:.|..||:|:    |  ||..  ||..:|||:|.|:.|...:..|
  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKL----GNLPEVAMPAENLQLIYSGRIMEDAMPLSEY 61

  Fly    62 NVDEKKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHT----NSPSSTNTEDS 122
            .:.|.|.||:|             ..|:.:|         |.|.|:...|    ..|:...|||.
  Fly    62 RIAEDKIIVLM-------------GKKKVDK---------SSPEEKVAPTPPLAAGPNVLRTEDV 104

  Fly   123 VLSRETRPLSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNP 187
            |.|                           |...|::   |..::.|||..|:|..|:.||:|:|
  Fly   105 VPS---------------------------LAPNDQW---VSDLMSMGYGEEEVRSALRASFNHP 139

  Fly   188 ERAVEYLINGIP----AEEGTFYNRLNESTNPSLIPSGPQPASATSAERSTESNSDPFEFLRSQP 248
            |||:||||||||    :|:|.           :.|||              ...||..:.|.:..
  Fly   140 ERAIEYLINGIPQEVVSEQGL-----------AAIPS--------------VQTSDQLQQLMADL 179

  Fly   249 QFLQMRSLIYQNPHLLHAVLQQIGQTNPALLQLISENQDAFLNMLNQPIDRESESGATVPPVSNA 313
            ...:||.:|.|||.|:|.::.::.:|:||..::...||:..:||::        .||       :
  Fly   180 NITRMREMINQNPELIHRLMNRLAETDPATFEVFQRNQEELMNMIS--------GGA-------S 229

  Fly   314 RIPSTLDNVDLFSPDLEVATSAQRSAAGTSAAHQSGSAADNEDLEQPLGVSTIRLNRQDKDAIER 378
            |.|:.:::       |::..:|:.:|                                   |:.|
  Fly   230 RTPNEIEH-------LQITLTAEETA-----------------------------------AVGR 252

  Fly   379 LKALGFPEALVLQAYFACEKNEEQAANFLLSSSFDD 414
            |:||||...:.:|||.||:|:|:.||..|:..|.:|
  Fly   253 LEALGFERVMAVQAYLACDKDEQLAAEVLIRQSEED 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 112/423 (26%)
RAD23_N 1..76 CDD:176400 28/78 (36%)
UBA1_Rhp23p_like 153..199 CDD:270561 22/45 (49%)
XPC-binding 242..296 CDD:286376 16/53 (30%)
UBA2_HR23A 371..411 CDD:270610 17/39 (44%)
CG10694NP_651212.1 rad23 1..284 CDD:273167 111/420 (26%)
UBQ 1..76 CDD:294102 28/91 (31%)
UBA1_Rad23_like 110..148 CDD:270466 18/40 (45%)
XPC-binding 172..227 CDD:286376 16/62 (26%)
UBA2_Rad23_like 245..282 CDD:270467 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470124
Domainoid 1 1.000 40 1.000 Domainoid score I4837
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53856
OrthoDB 1 1.010 - - D1260050at2759
OrthoFinder 1 1.000 - - FOG0001474
OrthoInspector 1 1.000 - - otm14359
orthoMCL 1 0.900 - - OOG6_101279
Panther 1 1.100 - - P PTHR10621
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1097
SonicParanoid 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.