DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and CG3223

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster


Alignment Length:360 Identity:66/360 - (18%)
Similarity:112/360 - (31%) Gaps:132/360 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FIVVMLTRD-SSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPS-------STNTEDSVL 124
            |||..:.:: :.:|:..||..:.:::.|::.:.:.|:....::...|.|       :.|..|.:.
  Fly   169 FIVDTIRKELARNSSATQLQEQAASESTTSSEEENSLGAGSSSSGGSSSTAVAAAAAANRRDEMA 233

  Fly   125 SRETRPLSSDELIGELAQA----SLQSRAESN---LLMGDEYNQTVLSMVEMGYPREQVERAMAA 182
            :  .|.:|..:|...||..    ||.:.|:.|   .:.|||..:|..:.                
  Fly   234 N--IRQISRQQLANALANVTPFNSLSNIAQRNADEAVQGDERPRTTSAP---------------- 280

  Fly   183 SYNNPERAVEYLINGIPAEEGTFYNRLNESTNPSLIPSGPQPASATSAERSTESNSDPFEFLRSQ 247
                        :.|:....||                     .|.|:..:..|.|...|.||::
  Fly   281 ------------LAGVGGAAGT---------------------GAGSSSGAISSGSISSELLRNE 312

  Fly   248 PQFLQMRSLIYQNPHLLHAVLQQIGQTNPALLQLISENQDAFLNMLNQPIDR-ESESGATVPPVS 311
                            |....|.:.|..||                  |::. |.|||....|..
  Fly   313 ----------------LARAFQSLSQDQPA------------------PVENMEVESGEGPVPEQ 343

  Fly   312 NARIPSTLDNVDLFSPDLEVATSAQRSAAGTSAAHQSGSAADNEDLEQPLGVSTIRLNRQDKDAI 376
            .|..|:  |:||                       ......|:.|: .|......|...|    :
  Fly   344 AATAPA--DDVD-----------------------DEDDGGDDSDV-LPRRYRRHRFTEQ----L 378

  Fly   377 ERLKALGFPEALVLQAYF-ACEKNEEQAANFLLSS 410
            ..:.|:||.......:|. ..:.|.|.|.|.|:.|
  Fly   379 RTMAAMGFINHTQNVSYLELSDGNVEHAINLLMLS 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 66/360 (18%)
RAD23_N 1..76 CDD:176400 3/7 (43%)
UBA1_Rhp23p_like 153..199 CDD:270561 5/45 (11%)
XPC-binding 242..296 CDD:286376 8/53 (15%)
UBA2_HR23A 371..411 CDD:270610 11/41 (27%)
CG3223NP_649758.1 UBA_like_SF 373..410 CDD:304366 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.