DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and ubl7b

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_005173742.1 Gene:ubl7b / 393331 ZFINID:ZDB-GENE-040426-1334 Length:371 Species:Danio rerio


Alignment Length:358 Identity:70/358 - (19%)
Similarity:124/358 - (34%) Gaps:132/358 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IYAGVILTDDRTVGSYNVDEKKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANH 110
            ::.|.:|.||.|:.||.:.....:.::                           |::.|..|.  
Zfish    61 VHCGCVLKDDLTLDSYGIKSGSTLHII---------------------------KKTWPEPEI-- 96

  Fly   111 TNSPSSTNTEDSVLSRETRPLSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQ 175
              .|...|.  |..:||.|.|          ||::.|.|        .|.:.|..|:.   .:|.
Zfish    97 --QPEPVNR--SAAAREFRML----------QAAMLSNA--------TYREAVFKMLA---NKES 136

  Fly   176 VERAMAASYNNPERAVEYLINGIPAEEGTFYNRLNESTNPSLIPSGPQPASATSAERSTESNSDP 240
            :::.:.||   |..:.:.:...:..::..|.    :.|:|:|:.:                    
Zfish   137 LDQIIVAS---PGLSSDPVALAVLQDKDLFV----QFTDPNLLDT-------------------- 174

  Fly   241 FEFLRSQPQFLQMRSLIYQNPHLLHAVLQQIGQTNPA-----------------LLQLISENQDA 288
              .:||.|..:....||      ||:|....||::..                 |...:|:::|.
Zfish   175 --LIRSHPSLVNAIILI------LHSVTSSSGQSSSGSSRSTAASSYSQMPGGFLFDGMSDDEDD 231

  Fly   289 FLNMLNQPIDRESESGATVPPVSNARIPSTLDNVDLFSP------DLEVATS-AQRSAAGTSAAH 346
            |        ...|..|::.|..::...|.||.:.....|      :|..|.: |....||.:|..
Zfish   232 F--------QSASRGGSSWPLRASGSRPGTLAHSGAMGPRPITQSELTHALALASTPEAGGTAPA 288

  Fly   347 QSGSAAD--------NEDLEQPL---GVSTIRL 368
            |.||||.        :..|:|.|   |||::::
Zfish   289 QDGSAAGAPVSSGLFSHALQQALQASGVSSLQV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 70/358 (20%)
RAD23_N 1..76 CDD:176400 7/29 (24%)
UBA1_Rhp23p_like 153..199 CDD:270561 7/45 (16%)
XPC-binding 242..296 CDD:286376 14/70 (20%)
UBA2_HR23A 371..411 CDD:270610
ubl7bXP_005173742.1 BMSC_UbP_N 15..89 CDD:176410 7/54 (13%)
Herpes_capsid <232..300 CDD:283714 19/75 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.