DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and CG7215

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001163644.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster


Alignment Length:82 Identity:34/82 - (41%)
Similarity:48/82 - (58%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSY-NVD 64
            |.||||.|:.:..|||.||..|:||:|.:|  |...:..|..|||:..|..|.:::|:.|| |:.
  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQI--EAELQISATNQKLLLLGRPLNNEQTIASYPNIK 63

  Fly    65 E--KKFIVVM--LTRDS 77
            |  |..:||:  ..|||
  Fly    64 EGTKLNLVVIKPCLRDS 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 34/82 (41%)
RAD23_N 1..76 CDD:176400 31/79 (39%)
UBA1_Rhp23p_like 153..199 CDD:270561
XPC-binding 242..296 CDD:286376
UBA2_HR23A 371..411 CDD:270610
CG7215NP_001163644.1 UBQ 1..72 CDD:214563 29/72 (40%)
ubiquitin 6..72 CDD:278661 25/67 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.