DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and Ubi-p5E

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster


Alignment Length:455 Identity:94/455 - (20%)
Similarity:160/455 - (35%) Gaps:121/455 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDE 65
            |.|.:|.|..:|.|:|..|..|:..:|.||.::.|  ...::|:||:||..|.|.||:..||:.:
  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPDQQRLIFAGKQLEDGRTLSDYNIQK 63

  Fly    66 KKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSST--NTEDSVLSRET 128
            :..:.::|......    |:.||.....|.|.:.:             ||.|  |.:..:..:|.
  Fly    64 ESTLHLVLRLRGGM----QIFVKTLTGKTITLEVE-------------PSDTIENVKAKIQDKEG 111

  Fly   129 RPLSSDELI--GE-------LAQASLQSRAESNLLM----GDEY------NQTVLSMVEMGYPRE 174
            .|.....||  |:       |:..::|..:..:|::    |.:.      .:|:...||   |.:
  Fly   112 IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE---PSD 173

  Fly   175 QVERAMAASYNN---PERAVEYLINGIPAEEG---TFYNRLNESTNPSL--IPSGPQPASATSAE 231
            .:|...|...:.   |......:..|...|:|   :.||...|||...:  :..|.|....|...
  Fly   174 TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG 238

  Fly   232 RSTESNSDPFEFLRSQPQFLQ--------MRSLIY----------------QNPHLLHAVLQQIG 272
            ::.....:|.:.:.:....:|        .:.||:                |....||.||:..|
  Fly   239 KTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG 303

  Fly   273 QTNPALLQLISENQDAFLNML-NQPIDRESESGATVPPVSNARIPS-TLDNVDLFSPDLEVATSA 335
                        ....|:..| .:.|..|.|             || |::||.....|.|.....
  Fly   304 ------------GMQIFVKTLTGKTITLEVE-------------PSDTIENVKAKIQDKEGIPPD 343

  Fly   336 QRSAAGTSAAHQSGSAADNEDLE-------------------QPLGVSTIRLNRQDKDAIERLKA 381
            |:.........:.|....:.:::                   :.|...||.|..:..|.||.:||
  Fly   344 QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA 408

  Fly   382  381
              Fly   409  408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 94/455 (21%)
RAD23_N 1..76 CDD:176400 25/74 (34%)
UBA1_Rhp23p_like 153..199 CDD:270561 10/58 (17%)
XPC-binding 242..296 CDD:286376 11/78 (14%)
UBA2_HR23A 371..411 CDD:270610 5/11 (45%)
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 25/76 (33%)
UBQ 1..72 CDD:214563 24/72 (33%)
Ubiquitin 77..152 CDD:176398 17/91 (19%)
UBQ 77..148 CDD:214563 17/87 (20%)
Ubiquitin 153..228 CDD:176398 15/77 (19%)
UBQ 153..224 CDD:214563 15/73 (21%)
Ubiquitin 229..304 CDD:176398 12/86 (14%)
UBQ 229..300 CDD:214563 10/70 (14%)
Ubiquitin 305..380 CDD:176398 14/87 (16%)
UBQ 305..376 CDD:214563 14/83 (17%)
Ubiquitin 381..456 CDD:176398 9/28 (32%)
UBQ 381..452 CDD:214563 9/28 (32%)
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.