DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and CG31528

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster


Alignment Length:279 Identity:61/279 - (21%)
Similarity:108/279 - (38%) Gaps:81/279 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEYLI 195
            :|:.|.|...|:.|  .|.|:..|..:|..:.:..:|.:.:     |:|::       |.:....
  Fly     1 MSTKESIDICAKGS--GRVETVTLRQNELIRNLRVLVAVRF-----EQAIS-------RIILVFA 51

  Fly   196 NGIPAEEGTFYN-------------RLNESTNPSLIPSGPQPASATSAERSTESNSDPFEFLRSQ 247
            ..:.::|||..:             |...:.:||     |.|.:||.               ||:
  Fly    52 GQVLSDEGTIDSRGIVSGVTVHVVCRAEAANSPS-----PTPIAATK---------------RSK 96

  Fly   248 PQFLQMRSLIYQNPHLLHA-----VLQQIGQTNPALLQLISENQDAFLNMLNQPID-RESESGAT 306
            |....|||  :|:.|:...     ||:.:.|.:|.:..|:.||. |..:.||...: ||..|.|.
  Fly    97 PSERLMRS--WQSAHIAFLQQEPDVLRSLLQADPRIRSLLDENA-AMRHYLNSDQNLREMLSLAF 158

  Fly   307 VPPVSNA------------------RIPSTLDNVDLFSPDLEVATSAQRSAAG--TSAAHQSGSA 351
            .|.....                  ::.|.|:...|.:.:..||.:.|:::.|  ||:..|.|. 
  Fly   159 SPAKQELGRRRDLHISRMEFVPGGYKVLSRLNYCMLQAYEDNVAMAFQQASQGAKTSSNPQRGL- 222

  Fly   352 ADNEDLEQPLGVSTIRLNR 370
                :::.||....:|:.|
  Fly   223 ----EVKDPLPNPWLRMPR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 61/279 (22%)
RAD23_N 1..76 CDD:176400
UBA1_Rhp23p_like 153..199 CDD:270561 6/45 (13%)
XPC-binding 242..296 CDD:286376 18/58 (31%)
UBA2_HR23A 371..411 CDD:270610 61/279 (22%)
CG31528NP_730833.1 UBQ 7..77 CDD:294102 14/83 (17%)
UBA_like_SF 299..335 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.