DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and Oas1i

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001009680.1 Gene:Oas1i / 304507 RGDID:1359379 Length:382 Species:Rattus norvegicus


Alignment Length:370 Identity:67/370 - (18%)
Similarity:116/370 - (31%) Gaps:134/370 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKKFIVVMLTRDSSSSNRNQLSVKES 90
            ||::.|  ||..:.....|::..|.........|..:.|    :||.|                 
  Rat    42 LKERCF--RGAAHPVRVSKVVKGGSSGKGTTLKGKSDAD----LVVFL----------------- 83

  Fly    91 NKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRPLSSDELIGELAQASLQSRAESNLLM 155
            |.|||.:|.                        |:|.      .|.|.|:.:...:.:.|.:..:
  Rat    84 NNLTSFEDQ------------------------LNRR------GEFIKEIKKQLYEVQRERHFGV 118

  Fly   156 GDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEYLINGIPAEEGTFYNRLNESTNPSLIPS 220
            ..|...:       .:|.   .||::...:.|....|...:.:||.:...:..:....:|.:..|
  Rat   119 KFEVQSS-------WWPN---PRALSFKLSAPHLQQEVEFDVLPAYDVLGHVSIYSMPDPQIYAS 173

  Fly   221 -----------GPQPASATSAERSTESNSDPFEFLRSQPQFLQMRSLIYQNPHLLHAVLQQIGQT 274
                       |......|..:|:         ||:.:|  .:::|||....:..|...:::|:.
  Rat   174 LIRKCMYLGKEGEFSTCFTELQRN---------FLKRRP--TKLKSLIRLVKYWYHLCKEKLGKP 227

  Fly   275 NP-----------------------------ALLQLISENQD------AFLNMLNQPIDRESESG 304
            .|                             |:|:||.:.|:      .:.|..:|.:.....:.
  Rat   228 LPPQYALELLTVYAWERGNGFVDFETAQGFRAVLELIIKYQELRIYWTTYYNFQHQEVSNYLHTQ 292

  Fly   305 ATVPPVSNARI-PSTLDNVDLFSPDLEVATS---AQRSAAGTSAA 345
            .|       || |..||..|   |...:|.|   ..|..||.:||
  Rat   293 LT-------RIRPVILDPAD---PTGNIAGSNPEGWRRLAGEAAA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 67/370 (18%)
RAD23_N 1..76 CDD:176400 12/49 (24%)
UBA1_Rhp23p_like 153..199 CDD:270561 6/45 (13%)
XPC-binding 242..296 CDD:286376 15/88 (17%)
UBA2_HR23A 371..411 CDD:270610
Oas1iNP_001009680.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390 42/243 (17%)
OAS1_C 164..348 CDD:287404 36/185 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.