DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT1G53980

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001319221.1 Gene:AT1G53980 / 28717352 AraportID:AT1G53980 Length:91 Species:Arabidopsis thaliana


Alignment Length:44 Identity:11/44 - (25%)
Similarity:23/44 - (52%) Gaps:3/44 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQK 44
            |.|.:..|:.:||.:|....:.:.::|..|.::..|   .:||:
plant    49 MSIFVSTLKGKTFNLEVKGSEIIQQVKNMIHDQVPP---VKKQE 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 11/44 (25%)
AT1G53980NP_001319221.1 Ubl1_cv_Nsp3_N-like 49..>87 CDD:475130 9/40 (23%)

Return to query results.
Submit another query.