DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and AT1G53950

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001319219.1 Gene:AT1G53950 / 28717351 AraportID:AT1G53950 Length:144 Species:Arabidopsis thaliana


Alignment Length:73 Identity:25/73 - (34%)
Similarity:39/73 - (53%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDE 65
            |:|.||.|..:|.|.|.....|:.|||.|..|:.|  ...|:|:||:.|.:|.|.:.:..||:..
plant    69 MMIFIKTLTGRTNTYEVKGSDTIRELKAKHEEKEG--IPVEQQRLIFQGRVLEDSKAISDYNIKH 131

  Fly    66 KKFIVVML 73
            :..:.:.|
plant   132 ESTLHITL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 25/73 (34%)
AT1G53950NP_001319219.1 Ubl1_cv_Nsp3_N-like 69..139 CDD:475130 24/71 (34%)

Return to query results.
Submit another query.