DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and Zfand4

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_038963095.1 Gene:Zfand4 / 286998 RGDID:628707 Length:815 Species:Rattus norvegicus


Alignment Length:416 Identity:84/416 - (20%)
Similarity:138/416 - (33%) Gaps:135/416 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDE 65
            |.:.|:.|....|.:..:|.:.|:.:|.||....|....  :|.||:..:.|.||..:..||:.|
  Rat    72 MELFIETLTGTCFELRVSPFEAVISVKGKIQRLEGIPIC--QQHLIWNNMELEDDYCLNDYNISE 134

  Fly    66 KKFIVVMLTRDSSSSNRNQLSVKES-NKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVL-SRET 128
            ...:.::|.......:..::.|::. .:|....||.:....|:       :|.|.:.:.| .||.
  Rat   135 GCTLKLVLAMRGGPISTRKVPVEDPLRELAEYMDSSRDEVWEK-------TSCNKQVTFLVYREG 192

  Fly   129 RPLSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEY 193
            ..|:...:: :....:|...:|| |..|..||.         |..|..|...:.|   .::.:|.
  Rat   193 DQLNFFRVV-DRGDGTLTPLSES-LSGGSVYNL---------YTDEDEETEPSPS---GQQIIEN 243

  Fly   194 LI--NGIPAEEGTFYNRLNESTNPSLI-------PSGPQPASATSAERSTESNSDPFEFLRSQPQ 249
            .|  |.:...:....| :|.|..|..:       |..|:|:|:::|...                
  Rat   244 SITMNKMKLLKAKMEN-MNLSKKPKKVVKVKPRPPIAPRPSSSSAAAAR---------------- 291

  Fly   250 FLQMRSLIYQNPHLLHAVLQQIGQTNPALLQLISENQDAFLNMLNQPIDRESESGATVPPVSNAR 314
                        |.|..||..|||                                :..|..||.
  Rat   292 ------------HRLLRVLPHIGQ--------------------------------SCLPSGNAY 312

  Fly   315 IPSTLDNVDLFSPDLEVATSAQRSAAGTSAAHQSGSAADNEDLEQPL--------------GVST 365
            :|.|..|                  ||||:|.|:.:......|...|              ..|:
  Rat   313 VPETSRN------------------AGTSSAAQAPADRPMPSLRSELLKDDGNWERNMLSHSTSS 359

  Fly   366 IRLNRQ--------DKDAIERLKALG 383
            |||..|        ||:..:.:..||
  Rat   360 IRLLPQLTHLDLENDKELPDSVLHLG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 84/416 (20%)
RAD23_N 1..76 CDD:176400 20/74 (27%)
UBA1_Rhp23p_like 153..199 CDD:270561 11/47 (23%)
XPC-binding 242..296 CDD:286376 7/53 (13%)
UBA2_HR23A 371..411 CDD:270610 5/21 (24%)
Zfand4XP_038963095.1 Ubl_ZFAND4 72..145 CDD:340500 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.