DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and Oas1b

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_653353.2 Gene:Oas1b / 246268 RGDID:708393 Length:379 Species:Rattus norvegicus


Alignment Length:209 Identity:43/209 - (20%)
Similarity:74/209 - (35%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 CEEANHTNSPSSTNTEDSVLSRETRPLSSDELIGELAQASLQSRAESNLLMGDEYNQT------- 162
            |.|::|....|......|  ||:...|..      .:.|.|....:|....||:.|:.       
  Rat    46 CRESSHPVRTSKVGKGGS--SRKGTTLKG------WSDADLVVFLDSFTCFGDQLNRRGEFTKEI 102

  Fly   163 ------------VLSMVEMGYPREQVERAMAASYNNPERAVEYLINGIPAEEGTFYNRLNESTNP 215
                        :...:|:........||::...:.|::..|...:.:||     |:.|..    
  Rat   103 KKLLFEVQRDRHIGVKIEVHSSWSPNHRALSFKLSAPDQQKEVKFDVLPA-----YDLLGH---- 158

  Fly   216 SLIPSGPQPASATS--AERSTESNSDPFE--FLRSQPQFL-----QMRSLIYQNPHLLHAVLQQI 271
            ..||..|.|....:  :||::....|.|.  |...|..||     :::|||....|......:::
  Rat   159 VCIPRKPNPQFYANLISERTSLGKEDEFSTCFTELQLYFLNWRPTKLKSLIRLVKHWYQLCKEKL 223

  Fly   272 GQTNPA--LLQLIS 283
            |...|.  .|:|::
  Rat   224 GDPLPPQYALELLT 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 43/209 (21%)
RAD23_N 1..76 CDD:176400
UBA1_Rhp23p_like 153..199 CDD:270561 8/64 (13%)
XPC-binding 242..296 CDD:286376 12/51 (24%)
UBA2_HR23A 371..411 CDD:270610
Oas1bNP_653353.2 NT_2-5OAS_ClassI-CCAase 27..176 CDD:143390 27/146 (18%)
OAS1_C 164..347 CDD:287404 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.