DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and Oas1f

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_660135.2 Gene:Oas1f / 243262 MGIID:2180855 Length:364 Species:Mus musculus


Alignment Length:316 Identity:61/316 - (19%)
Similarity:100/316 - (31%) Gaps:114/316 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDEKKFIVVM--LTRDSSSSNRNQLSVK 88
            ||::.|:  |..:.....:::..|   :.|......:..|.|.:|.:  ||.......|....::
Mouse    42 LKERCFQ--GATHPVRVSRVVMGG---SYDEHTALKSKSEAKMVVFLNNLTSFEEQLKRRGEFIE 101

  Fly    89 ESNK-LTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETRPLSSDELIGELAQASLQSRAESN 152
            |..| |....|.|......|...:..|:|.:     ||.:   |||.||                
Mouse   102 EIRKHLCQLQDEKPFKVKFEVQSSEEPNSRS-----LSFK---LSSPEL---------------- 142

  Fly   153 LLMGDEYNQTVLSMVEMGYPREQVERAMAASYN------NPERAVEYLINGIPAE---------- 201
                                :::||..:..:|:      |.:.|..||.|.|.|:          
Mouse   143 --------------------QQEVEFDVQPAYDVLYELRNNKYAELYLYNKIYAQLIHECTTLKK 187

  Fly   202 EGTF-------YNRLNESTNPSL-------------------IPSGPQPASATSAERSTESNSDP 240
            ||.|       :....|...|.|                   .|..||.|.......:.||.|..
Mouse   188 EGEFSICFTDLHQSFLEDRAPKLKNLIRLVKHWYQLCKEKLGKPLPPQYALELLTVYAWESGSRD 252

  Fly   241 FEF-----------LRSQPQFLQMRSLIYQN------PHLLHAVLQQIGQTNPALL 279
            .||           |.::.::|::...:|.:      ...||.:||::   .|.:|
Mouse   253 CEFNTAQGFRTVLELVTKYKWLRIYWTVYYDFRKTKVSEYLHKMLQKV---RPVIL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 61/316 (19%)
RAD23_N 1..76 CDD:176400 11/51 (22%)
UBA1_Rhp23p_like 153..199 CDD:270561 8/51 (16%)
XPC-binding 242..296 CDD:286376 11/55 (20%)
UBA2_HR23A 371..411 CDD:270610
Oas1fNP_660135.2 NT_2-5OAS_ClassI-CCAase 27..>157 CDD:143390 30/163 (18%)
OAS1_C 171..352 CDD:287404 27/138 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.