DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and F52C6.3

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_494127.2 Gene:F52C6.3 / 186085 WormBaseID:WBGene00018660 Length:197 Species:Caenorhabditis elegans


Alignment Length:141 Identity:27/141 - (19%)
Similarity:46/141 - (32%) Gaps:55/141 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNVDE 65
            |:::||....:..|:| ||:....|::.|                  .||:.|.....|:     
 Worm     1 MLLSIKTSTGKNITVE-APKSVKTEVRDK------------------QGVVFTVSYDKGT----- 41

  Fly    66 KKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTN-TEDSVLSRETR 129
                                    .|::...:|:.|.:..:||.......|.. |||.:      
 Worm    42 ------------------------GNQIIEMEDTVQDVKIQEAQQAPLRESEEVTEDPI------ 76

  Fly   130 PLSSDELIGEL 140
            .:.|.|:||.|
 Worm    77 SVESSEVIGNL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 27/141 (19%)
F52C6.3NP_494127.2 Ubl1_cv_Nsp3_N-like 103..173 CDD:475130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.