DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and Nedd8

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_032709.1 Gene:Nedd8 / 18002 MGIID:97301 Length:81 Species:Mus musculus


Alignment Length:63 Identity:18/63 - (28%)
Similarity:35/63 - (55%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGSYNV 63
            |:|.:|.|..:...|:..|...|..:|:::.|:.|  ...::|:|||:|..:.|::|...|.:
Mouse     1 MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEG--IPPQQQRLIYSGKQMNDEKTAADYKI 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 18/63 (29%)
Nedd8NP_032709.1 Ubl_NEDD8 3..76 CDD:340504 17/61 (28%)
Interaction with UBE1C. /evidence=ECO:0000250|UniProtKB:Q15843 70..72
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.