DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and C16C8.14

DIOPT Version :10

Sequence 1:NP_651918.2 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_494545.1 Gene:C16C8.14 / 173689 WormBaseID:WBGene00015852 Length:233 Species:Caenorhabditis elegans


Alignment Length:116 Identity:31/116 - (26%)
Similarity:46/116 - (39%) Gaps:30/116 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 SDPFEFLRSQPQFLQMRSLIYQN---------PHLLHAVLQQIGQ---TNPALLQLISENQDAFL 290
            |||.: |.|:.|.|::.:...||         ...||...|:|.|   ......|...|||:||:
 Worm     2 SDPRD-LMSEFQKLRVETSKIQNEFKEKPGYVEDKLHKNTQEICQQILKKQGKSQKSQENQNAFI 65

  Fly   291 -NMLNQPIDRESESGATVPPVSNARIPSTLDNVDLFSPDLEVATSAQRSAA 340
             |::::....:|:...|...:|                ||..||..|.|.|
 Worm    66 ENLMSELKTAKSKLNETENQIS----------------DLHEATKQQESQA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_651918.2 rad23 1..413 CDD:273167 31/116 (27%)
C16C8.14NP_494545.1 UBQ 170..228 CDD:214563
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.