DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad23 and UBL4B

DIOPT Version :9

Sequence 1:NP_001259052.1 Gene:Rad23 / 43785 FlyBaseID:FBgn0026777 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_981957.1 Gene:UBL4B / 164153 HGNCID:32309 Length:174 Species:Homo sapiens


Alignment Length:247 Identity:50/247 - (20%)
Similarity:91/247 - (36%) Gaps:82/247 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEE-RGPEYVAEKQKLIYAGVILTDDRTVGSYNVD 64
            |.:|:|.|..|..:::.:.:::|..||:.:... :.||   |:|.|::.|.:|.||:.:..|.:.
Human     1 MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPE---EQQHLLFRGQLLEDDKHLSDYCIG 62

  Fly    65 EKKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSKQSMPCEEANHTNSPSSTNTEDSVLSRETR 129
            ....|.|::                        ...:.|..:||:...:....:....||::...
Human    63 PNASINVIM------------------------QPLEKMALKEAHQPQTQPLWHQLGLVLAKHFE 103

  Fly   130 PLSSDELIGELAQASLQSRAESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEYL 194
            |        :.|:|.||      ||.                 :|..||....|..:.|:..:||
Human   104 P--------QDAKAVLQ------LLR-----------------QEHEERLQKISLEHLEQLAQYL 137

  Fly   195 INGIPAEEGTFYNRLNESTNPSLIPSG-------PQPASATSAERSTESNSD 239
            :    |||            |.:.|:|       .:|.|:...|...|:.:|
Human   138 L----AEE------------PHVEPAGERELEAKARPQSSCDMEEKEEAAAD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad23NP_001259052.1 rad23 1..413 CDD:273167 50/247 (20%)
RAD23_N 1..76 CDD:176400 20/75 (27%)
UBA1_Rhp23p_like 153..199 CDD:270561 9/45 (20%)
XPC-binding 242..296 CDD:286376
UBA2_HR23A 371..411 CDD:270610
UBL4BNP_981957.1 UBQ 1..74 CDD:320785 20/99 (20%)
FlhF 20..>154 CDD:332151 40/207 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..174 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.