DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rad23 and Oas1d

DIOPT Version :9

Sequence 1:	NP_001259052.1	Gene:	Rad23 / 43785	FlyBaseID:	FBgn0026777	Length:	414	Species:	Drosophila melanogaster
Sequence 2:	NP_598654.1	Gene:	Oas1d / 100535	MGIID:	2140770	Length:	361	Species:	Mus musculus

Alignment Length:	104	Identity:	19/104 - (18%)
Similarity:	39/104 - (37%)	Gaps:	39/104 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly   145 LQSRAESNLLM--------GDEYNQTVLSM-------------------VEMGYPREQVERAMAA 182
            |:.|:|:|:::        .|::|..|:.:                   .|:..|:|...|.::.
Mouse    71 LKGRSEANMVVFLINLTSFEDQFNGQVVFIEEIWRHLLQLQQEKLCKLKFEVQSPKEPNSRFLSF 135

  Fly   183 SYNNPERAVEYLINGIPAEEGTF------------YNRL 209
            ..:.|||..|...:..||.:..:            ||::
Mouse   136 KLSCPERQHELEFDVQPAYDALYEVRHFKPFDSSNYNKV 174

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rad23	NP_001259052.1	rad23	1..413	CDD:273167	19/104 (18%)
		RAD23_N	1..76	CDD:176400
		UBA1_Rhp23p_like	153..199	CDD:270561	11/72 (15%)
		XPC-binding	242..296	CDD:286376
		UBA2_HR23A	371..411	CDD:270610
Oas1d	NP_598654.1	NT_Pol-beta-like	27..>157	CDD:325146	17/85 (20%)
Oas1d	NP_598654.1	OAS1_C	173..354	CDD:313619	0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900