DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and AT1G03370

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_171836.3 Gene:AT1G03370 / 839519 AraportID:AT1G03370 Length:1020 Species:Arabidopsis thaliana


Alignment Length:139 Identity:52/139 - (37%)
Similarity:78/139 - (56%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQS 228
            |.::|::.:.|||.||:|.||||||:.|   .|.|..||:.::.|||:|.|.|   .|.:..|..
plant     3 LQVRVVEARNLPAMDLNGFSDPYVRLQL---GKQRSRTKVVKKNLNPKWTEDF---SFGVDDLND 61

  Fly   229 RVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSF---WKALKPP---AKDKCGELLSSLCYH 287
            .:: :.|.|.|::..||.:|:|.:.:..|..|..||.   |..|.|.   :|..|||:|..:|:.
plant    62 ELV-VSVLDEDKYFNDDFVGQVRVSVSLVFDAENQSLGTVWYPL
NPKKKGSKKDCGEILLKICFS 125

  Fly   288 PSNSILTLT 296
            ..||:|.||
plant   126 QKNSVLDLT 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 40/109 (37%)
C2B_Synaptotagmin-7 277..414 CDD:176050 10/20 (50%)
AT1G03370NP_171836.3 C2 2..104 CDD:395116 39/107 (36%)
DUF4782 252..401 CDD:406424
C2 535..637 CDD:395116
PH-GRAM_C2-GRAM 699..812 CDD:270039
DUF4782 851..992 CDD:406424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1065
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.