DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and SYT16

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001354585.1 Gene:SYT16 / 83851 HGNCID:23142 Length:645 Species:Homo sapiens


Alignment Length:406 Identity:96/406 - (23%)
Similarity:166/406 - (40%) Gaps:59/406 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ESSSYSLRAAQDIVDSGNPPTKPQVP----------VAHAITTPLQNNINRKLNGFLSLRTPLIG 101
            |:.||.        :..:.|...|.|          .:|..::.:|:...:...|.|.:.| ...
Human   257 ENLSYG--------EDDHIPAHSQSPCERGDAKHHGTSHQESSVVQSLRRQSTEGSLEMET-AFN 312

  Fly   102 GSGASQTKPQIISSVGNPGDGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLIL 166
            ..|...:.....||:.:|.:   :|..|..:..     ..::|....|.:....||...:..|.:
Human   313 SRGFEDSYATDSSSMWSPEE---QDRTNLQVPS-----GVSEPISKCGDLDVIFEYRAASQKLTV 369

  Fly   167 KVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVL 231
            .:::.:.||.||.||.:...|.|.|||.||||..|.|:|.. ||.:.|...|.....:.:.:..:
Human   370 TIVRAQGLPDKDRSGVNSWQVHVVLLPGKKHRGRTNIQRGP-NPVFREKVTFAKLEPRDVAACAV 433

  Fly   232 HLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCG------------------ 278
            ...::...:.:|:..:||....|..:...|:......|:|.:....|                  
Human   434 RFRLYAARKMTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSST 498

  Fly   279 ---------ELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWL--QFGDKRVEKRKT 332
                     |||..|.|:.:...|::.:||..:.:...:|...|.|.|::|  ..| :.:.:.||
Human   499 QSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVG-QEMSRCKT 562

  Fly   333 PIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQ 397
            .|.....|||:.|:|.|.|...::.:.:|.:.|.:...:.|.|:||.|.| |:|.||..|..||:
Human   563 SIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIAL-GQNSSGEEEQDHWE 626

  Fly   398 DMISKPRQTVVQWHRL 413
            :|.....|.:.:||.|
Human   627 EMKETKGQQICRWHTL 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 32/123 (26%)
C2B_Synaptotagmin-7 277..414 CDD:176050 45/166 (27%)
SYT16NP_001354585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..344 17/103 (17%)
C2A_Synaptotagmin-14_16 350..473 CDD:176035 32/123 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..503 1/24 (4%)
C2B_Synaptotagmin-14_16 506..643 CDD:176053 44/139 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.