DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and AT5G50170

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_199828.1 Gene:AT5G50170 / 835082 AraportID:AT5G50170 Length:1027 Species:Arabidopsis thaliana


Alignment Length:177 Identity:45/177 - (25%)
Similarity:70/177 - (39%) Gaps:39/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYF------EGFP 222
            |.:.:||.|:||||:         ....|...:|:.:|::.|.|.:|.|||.|.|      ||  
plant     3 LYVYILQAKDLPAKE---------TFAKLHVGRHKSKTRVARDTSSPIWNEEFVFRISDVDEG-- 56

  Fly   223 IQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSF---WKALKPPAKDK-----CGE 279
             ..:...:||....|:........||:|.:||..|.....|:.   |..::.|:..|     ||:
plant    57 -DDVVVSILHHEQQDHQSIVSTGLIGKVRIPLTSVAAEENQTLLPTWFVIEKPSDGKFVNIECGK 120

  Fly   280 LLSSL-------------CYHPSNSILTLTLIKARNLKAKDINGKSD 313
            :|.||             ..:....|:.|..:|......||:....|
plant   121 ILLSLSLQGKWESTSGEKVLNDKQDIINLEGVKELEGSPKDLISSRD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 32/115 (28%)
C2B_Synaptotagmin-7 277..414 CDD:176050 11/50 (22%)
AT5G50170NP_199828.1 C2 3..105 CDD:175973 32/113 (28%)
DUF4782 260..406 CDD:374299
C2 540..641 CDD:365917
PH-like 703..816 CDD:388408
DUF4782 864..1001 CDD:374299
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1065
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.