DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and AT2G21010

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_179697.2 Gene:AT2G21010 / 816635 AraportID:AT2G21010 Length:256 Species:Arabidopsis thaliana


Alignment Length:263 Identity:67/263 - (25%)
Similarity:110/263 - (41%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDD 245
            |..:|||::.|..||....:|.:|.:.|||.|||.|.|.   ::..:::||..:|:.:::..:.|
plant     2 GMINPYVQIELSEDKISSKKTTVKHKNLNPEWNEEFKFS---VRDPKTQVLEFNVYGWEKIGKHD 63

  Fly   246 SIGEVFLPLCQVDFAGKQSFWKALK---------PPAKDKCGELLSSLCYHPSNSILTLTLIKAR 301
            .:|...|.|.::....:::|...|:         .|.|.: |:|...|.|.|........:.||.
plant    64 KMGMNVLALKELAPDERKAFTLELRKTLDGGEEGQPGKYR-GKLEVELLYKPFTEEEMQAVQKAP 127

  Fly   302 N-------------LKAKDINGK--SDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNV 351
            .             ..|:|:.||  ::|||.::.     :.|:|||.......:|.:||.|||.:
plant   128 EGTPVAGGMLVVIVHSAEDVEGKHHTNPYVHIYF-----KGEERKTKNVKKNKDPKWNEEFSFML 187

  Fly   352 PWEKIRECSLDVMVMDFDN-IG---RNELIGRI------------------LLAGKNGSGASETK 394
            ....:.| .|.|.|....: ||   ..|.:|.:                  |:..|||....|. 
plant   188 EEPPVHE-KLHVEVFSTSSRIGLLHPKETLGYVDIPVVDVVNNKRMNQKFHLIDSKNGKIQIEL- 250

  Fly   395 HWQ 397
            .||
plant   251 DWQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 26/98 (27%)
C2B_Synaptotagmin-7 277..414 CDD:176050 39/158 (25%)
AT2G21010NP_179697.2 C2 2..87 CDD:278593 25/87 (29%)
C2 135..238 CDD:278593 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3225
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.