DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and SYT5

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_003171.2 Gene:SYT5 / 6861 HGNCID:11513 Length:386 Species:Homo sapiens


Alignment Length:318 Identity:128/318 - (40%)
Similarity:195/318 - (61%) Gaps:30/318 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 KDSANKSISMTDM------YLDSTDP------------------SENVGQIHFSLEYDFQNTTLI 165
            |..|...:.:.::      |:|...|                  ...:|::.:||:||||:..|:
Human    62 KSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPSGPGQQVADKHELGRLQYSLDYDFQSGQLL 126

  Fly   166 LKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRV 230
            :.:||...|.|.||.|:|||||||.|||||:.|.|||:.|:||||.:.|||.|: .|..:|..||
Human   127 VGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFK-VPYVELGGRV 190

  Fly   231 LHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAK---DKCGELLSSLCYHPSNSI 292
            |.:.|:|:|||||:|:||||.:|:..||.......|:.|:...:   :|.|::..||.|.|:...
Human   191 LVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAPREEQEKLGDICFSLRYVPTAGK 255

  Fly   293 LTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIR 357
            ||:.:::|:|||..|:.|.|||||||.|..|.|:|.|:||.|...||||.:||:|||.||.::::
Human   256 LTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQ 320

  Fly   358 ECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKP 415
            :..:::.|:|:|.:|:||.|||:.:..  .:|.:..:||.||::.||:.:.|||.|:|
Human   321 KVQVELTVLDYDKLGKNEAIGRVAVGA--AAGGAGLRHWADMLANPRRPIAQWHSLRP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 62/123 (50%)
C2B_Synaptotagmin-7 277..414 CDD:176050 58/136 (43%)
SYT5NP_003171.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
C2A_Synaptotagmin-1-5-6-9-10 109..231 CDD:176031 62/122 (51%)
C2 240..374 CDD:387358 58/135 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.