DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and Doc2g

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_068563.2 Gene:Doc2g / 60425 MGIID:1926250 Length:387 Species:Mus musculus


Alignment Length:306 Identity:87/306 - (28%)
Similarity:141/306 - (46%) Gaps:39/306 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 TDPSENVGQIHFSLEYDFQNTTLILKVLQGKEL--PAKDLSGTSDPYVRVTLLP--DKKHRLETK 202
            :|.|..:|.:.|:|.:|..|:.|.....:.|.|  ||   :|:.|.||:..|||  .|..:|.|:
Mouse    78 SDDSTALGTLEFTLLFDEDNSALHCTAHRAKGLKPPA---AGSVDTYVKANLLPGASKASQLRTR 139

  Fly   203 IKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRF---SRDDSIGEVFLPL---------- 254
            ..|.|..|.|.||..:.||..|....:.|.|.|.:..|.   .|...:||:.:||          
Mouse   140 TVRGTREPVWEETLTYHGFTCQDAGRKTLRLCVCEDSRLRRRRRGPPLGELRVPLRKLVPNRARS 204

  Fly   255 ---C-----------QVDFAGKQSFWKALKPPAK---DKCGELLSSLCYHPSNSILTLTLIKARN 302
               |           .:|.|...|.::..:..|:   ::.|.:|.||||......|.:.:::..:
Mouse   205 FDICLEKRKLTKRPKSLDTARGMSLYEEEEMEAEVFGEERGRILLSLCYSSERGGLLVGVLRCVH 269

  Fly   303 LKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMD 367
            |...|.||.|||:|:::|.....:..|.||.:...||||.|||.|.:....|::.:.:|.|.|.|
Mouse   270 LAPMDANGYSDPFVRLFLHPSSGKKSKYKTSVRRKTLNPEFNEEFFYAGHREELAQKALLVSVWD 334

  Fly   368 FDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRL 413
            :|....::.||.:.|:|:  :.....:||::.:......:..||.|
Mouse   335 YDLGTADDFIGGVQLSGR--ASGERLRHWRECLGHCDHRLELWHLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 42/154 (27%)
C2B_Synaptotagmin-7 277..414 CDD:176050 42/137 (31%)
Doc2gNP_068563.2 C2A_Rabphilin_Doc2 84..209 CDD:176000 38/127 (30%)
C2 246..378 CDD:301316 40/133 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.