DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and Syt10

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_061273.1 Gene:Syt10 / 54526 MGIID:1859546 Length:523 Species:Mus musculus


Alignment Length:475 Identity:154/475 - (32%)
Similarity:246/475 - (51%) Gaps:93/475 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIVLIA-CLAILGL-IITIALFLAGGYLW--WRHKRSQLQFIEPN-------------------- 43
            |:.|:| .::..|| ::.::||:.....|  |:.|     .:.||                    
Mouse    53 SVSLLAVVVSFCGLALLVVSLFVFWKLCWPCWKSK-----LVAPNLSVLPQSISSAPTEVFETEE 112

  Fly    44 --EDEESSSYSLRAAQDIVDSGNPPTKPQVP-----------VAHA-----ITTP--------LQ 82
              |.||:...:.:|.:..:...:  |.|.:|           :.||     .|.|        .:
Mouse   113 KKEVEENEKPAPKAIEPAIKISH--TSPDIPAEVQTALKEHLIKHARVQRQTTEPTSSSRHNSFR 175

  Fly    83 NNINRKLNGF---LSLRTPLIGGSGASQT-----KPQIISSVGNPGDGTTKDSANKSISMTDMYL 139
            .::.|::|..   .|:.|..|...|.::|     ||::........:|..||..           
Mouse   176 RHLPRQMNVSSVDFSVGTEPILQRGETRTSIGRIKPELYKQKSVDSEGNRKDDV----------- 229

  Fly   140 DSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIK 204
                  :..|:::|:|:||::|..|::|:::..:|||||.:|||||||::.||||:|.:.:|::.
Mouse   230 ------KTCGKLNFALQYDYENELLVVKIIKALDLPAKDFTGTSDPYVKIYLLPDRKKKFQTRVH 288

  Fly   205 RRTLNPRWNETFYFEGFPI--QKLQSRVLHLHVFDYDRFSRDDSIGEVFLP-LCQV-DFAGKQSF 265
            |:||||.::|.|.   ||:  .:|.:|.||..::|:|||||.|.||||.|. |.:| |.:.:.:.
Mouse   289 RKTLNPLFDELFQ---FPVVYDQLSNRKLHFSIYDFDRFSRHDMIGEVILDNLFEVSDLSREATV 350

  Fly   266 WKALKPPAKDK--CGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVE 328
            ||.:.....:.  .||::.||||.|:...:|||:||.|||||.||.|.|||||||.|....:|::
Mouse   351 WKDIHCATTESIDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLK 415

  Fly   329 KRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASET 393
            ||||.....|||||:||:..|::|.|.:.:.||.:.|||:|.:|.||:|| :...|.:..|... 
Mouse   416 KRKTTTKKNTLNPVYNEAIIFDIPPENVDQVSLCIAVMDYDRVGHNEVIG-VCRTGLDAEGLGR- 478

  Fly   394 KHWQDMISKPRQTVVQWHRL 413
            .||.:|::..|:.:..||.|
Mouse   479 DHWNEMLAYHRKPITHWHPL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 56/127 (44%)
C2B_Synaptotagmin-7 277..414 CDD:176050 63/137 (46%)
Syt10NP_061273.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 13..35
C2A_Synaptotagmin-1-5-6-9-10 231..356 CDD:176031 56/127 (44%)
C2B_Synaptotagmin-3-5-6-9-10 365..498 CDD:176048 62/134 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.