DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and Sytbeta

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster


Alignment Length:363 Identity:111/363 - (30%)
Similarity:173/363 - (47%) Gaps:61/363 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LRTP---------LIGGSGASQT------------KPQIISSVGNPGDGTTKDSAN-------KS 131
            ||||         |.||||...:            .|.:|.....||.......|:       ..
  Fly   258 LRTPSPSQSSLASLAGGSGMGGSSAGKGVAGGRCLSPLLIPPRSQPGVDPAMGPASPLGALQPDL 322

  Fly   132 ISMTD--MYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP- 193
            ..|.|  :||.:.:.|..||::|..::||:....|.:.:::...|...:..|..|||||:.|.| 
  Fly   323 YRMPDGPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPE 387

  Fly   194 -DKKHRLETKIKRRTLNPRWNETFYFEGFPIQK--LQSRVLHLHVFDYDRFSRDDSIGEVFLPLC 255
             |.:.| :|.|.|...||.:::.|   .||:.:  ||.:.|.|.|.||||:|.:|.||||.:.:.
  Fly   388 VDSRKR-QTHIHRGESNPYFDQHF---KFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVD 448

  Fly   256 QVDFAGKQSFWKAL---KPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVK 317
            .:|.:.....|..|   |.|.:|: .|||.||.|.|....||:.::|||||     :...:||||
  Fly   449 GLDLSKSVEIWGDLLRTKKPKEDR-PELLCSLNYLPQAERLTVVIMKARNL-----DTLQEPYVK 507

  Fly   318 VWLQFGDKRVEKRKTPIFTC--TLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGRNELIGRI 380
            ::|....||::|:||.|...  ..||::||:|:||:....:...::::.|     :|.......|
  Fly   508 IYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYV-----VGAGSEATEI 567

  Fly   381 LLAG----KNGSGASETKHWQDMISKPRQTVVQWHRLK 414
            ...|    ::|:|.   :||.|||:..|:....||.::
  Fly   568 GCCGLGPQESGTGC---QHWHDMINNARKPTAMWHYIR 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 43/130 (33%)
C2B_Synaptotagmin-7 277..414 CDD:176050 46/142 (32%)
SytbetaNP_648734.1 C2 341..463 CDD:301316 42/125 (34%)
C2B_Synaptotagmin 473..601 CDD:175975 46/140 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.