DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and PLA2G4F

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_998765.3 Gene:PLA2G4F / 255189 HGNCID:27396 Length:849 Species:Homo sapiens


Alignment Length:224 Identity:51/224 - (22%)
Similarity:80/224 - (35%) Gaps:61/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 YDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGF 221
            ||.|     :|||:...:...||...:|.||::.|........:|:|.....:|.|||||:::  
Human    44 YDLQ-----VKVLRATNIRGTDLLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQ-- 101

  Fly   222 PIQKLQSRVLHLHVFDYDRFSRDDSIGEVF--------------LPL-------CQVDFAGKQSF 265
             |......||.|.::|.|....|.....:|              .||       .||:|..::| 
Human   102 -IHGAVKNVLELTLYDKDILGSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKS- 164

  Fly   266 WKALKPPAKDKCGELLSS--LCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFG----- 323
                :.||    .|::::  |..||        .::.:.....|.....:.|....||..     
Human   165 ----QVPA----SEVITNGVLVAHP--------CLRIQGTLRGDGTAPREEYGSRQLQLAVPGAY 213

  Fly   324 --------DKRVEKRKTPIFTCTLNPVFN 344
                    ....|....|.||..:|||.:
Human   214 EKPQLLPLQPPTEPGLPPTFTFHVNPVLS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 34/134 (25%)
C2B_Synaptotagmin-7 277..414 CDD:176050 15/83 (18%)
PLA2G4FNP_998765.3 C2_cPLA2 46..163 CDD:176001 31/124 (25%)
PLAc 295..791 CDD:214474
cPLA2_Grp-IVB-IVD-IVE-IVF 303..845 CDD:132840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.