DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and RPH3A

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001137326.1 Gene:RPH3A / 22895 HGNCID:17056 Length:694 Species:Homo sapiens


Alignment Length:407 Identity:121/407 - (29%)
Similarity:181/407 - (44%) Gaps:84/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PPTKPQV-PVAHAITTPLQNNINRKLNGFLSLRTPLIGG------------SGASQTKPQIISSV 116
            |..||:| |.....|.|.:......:.|:     |.:|.            |.||...||..::.
Human   311 PDQKPEVAPSDPGTTAPPREERTGGVGGY-----PAVGAREDRMSHPSGPYSQASAAAPQPAAAR 370

  Fly   117 GNPGDGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSG 181
            ..|.....::.||.        .|| |.:..:|.:.|||.||..|::|...:::.|.|...|.:|
Human   371 QPPPPEEEEEEANS--------YDS-DEATTLGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNG 426

  Fly   182 TSDPYVRVTLLP--DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRD 244
            .:||||::.|||  .|.::|.||..|.|.||.||||..:.|...:.:|.:.|.:.|.|.|:|..:
Human   427 LADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHN 491

  Fly   245 DSIGEVFLPLCQVDFAGKQSFWKALKP--------------PAK--------------------- 274
            :.|||....|            |.|||              |.|                     
Human   492 EFIGETRFSL------------KKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVER 544

  Fly   275 ----DKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIF 335
                ::.|::|.||.|......|.:.:|:..:|.|.|.||.|||:||:||:....:..|.||.|.
Human   545 VGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIK 609

  Fly   336 TCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGR-NELIGRILLAGKNGSGASETKHWQDM 399
            ..||||.|||.|.:::....:.:.|||:.|.|:| ||: |:.||...| |.:..| ...|||.:.
Human   610 KKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYD-IGKSNDYIGGCQL-GISAKG-ERLKHWYEC 671

  Fly   400 ISKPRQTVVQWHRLKPE 416
            :....:.:.:||:|:.|
Human   672 LKNKDKKIERWHQLQNE 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 44/125 (35%)
C2B_Synaptotagmin-7 277..414 CDD:176050 50/137 (36%)
RPH3ANP_001137326.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
FYVE_RP3A 92..171 CDD:277301
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..388 20/90 (22%)
C2A_Rabphilin_Doc2 393..516 CDD:176000 46/134 (34%)
C2B_Rabphilin_Doc2 553..685 CDD:176030 49/134 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X85
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.