DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt7 and Rph3a

DIOPT Version :9

Sequence 1:NP_726557.3 Gene:Syt7 / 43783 FlyBaseID:FBgn0039900 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_011246487.1 Gene:Rph3a / 19894 MGIID:102788 Length:684 Species:Mus musculus


Alignment Length:382 Identity:112/382 - (29%)
Similarity:174/382 - (45%) Gaps:52/382 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPGDGTTKDSAN 129
            ||:.|..|.|.|                 ..|....|.:|..|..|...:.............|.
Mouse   319 PPSDPGYPGAVA-----------------PAREERTGPAGGFQAAPHTAAPYSQAAPARQPPPAE 366

  Fly   130 KSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP- 193
            :.....:.|  .:|.:..:|.:.|||.||..|:.|...:::.|.|...|.:|.:||||::.||| 
Mouse   367 EEEEEANSY--DSDEATTLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPG 429

  Fly   194 -DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV 257
             .|.::|.||..|.|.||.||||..:.|...:.:|.:.|.:.|.|.|:|..::.|||....|.::
Mouse   430 ASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKL 494

  Fly   258 DFAGKQSFWKALKP--PAK-------------------------DKCGELLSSLCYHPSNSILTL 295
            ....:::|...|:.  |.|                         ::.|::|.||.|......|.:
Mouse   495 KANQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERIGDIEERGKILVSLMYSTQQGGLIV 559

  Fly   296 TLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECS 360
            .:|:..:|.|.|.||.|||:||:||:....:..|.||.|...||||.|||.|.:::....:.:.|
Mouse   560 GIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKS 624

  Fly   361 LDVMVMDFDNIGR-NELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE 416
            ||:.|.|:| ||: |:.||...| |.:..| ...|||.:.:....:.:.:||:|:.|
Mouse   625 LDISVWDYD-IGKSNDYIGGCQL-GISAKG-ERLKHWYECLKNKDKKIERWHQLQNE 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt7NP_726557.3 C2A_Synaptotagmin-7 147..271 CDD:176032 44/125 (35%)
C2B_Synaptotagmin-7 277..414 CDD:176050 50/137 (36%)
Rph3aXP_011246487.1 FYVE_RP3A 88..168 CDD:277301
PRK07764 <175..352 CDD:236090 11/49 (22%)
C2A_Rabphilin_Doc2 383..506 CDD:176000 43/122 (35%)
C2B_Rabphilin_Doc2 543..675 CDD:176030 49/134 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X85
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.